AIChat0123 |

Chatbots

Your favorite content. Transcribed and searchable. Context is an AI-powered search engine that can find any moment you're looking for within large collections of audio and video content. You can search content of creators like Mr Beast and MKBHD.

Chefgpt

ChefGPT.xyz provides AI-powered recipe recommendations based on the ingredients that are available. You can select the ingredients you have, the kitchen tools you have, how much time is available to you, your level of cooking skills and different "Chef Modes" such as Gourmet Mode and All-In Mode, which allow users to customize their recipes.

ChatGPT

ChatGPT is a natural language processing tool driven by AI technology that allows you to have human-like conversations and much more with a chatbot. The language model can answer questions, and assist you with tasks such as composing emails, essays, and code.

ChatGPT

Others

Rankode

Recruiters, everything you need to know about a candidate's programming skills is in their GitHub. Evaluate them automatically with Rankode to avoid expensive hiring mistakes and superboost your retention.

Qure.AI

Qure.ai taps deep learning technology to provide automated interpretation of radiology exams like X-rays, CTs and Ultrasounds scans for time and resource-strapped medical imaging professionals—enabling faster diagnosis and speed to treatment.

Genius Sheets

Genius Sheets AI Text To Reports solutions help you analyze financial data faster - empowering teams to make better decisions. Stay in Excel and Google Sheets and automate your financial reporting process with live data connections.

AI Social Media Post Writerby Socialblu

SocialBu is the perfect solution to improve your social media presence and maximize your results. Publish, Respond, Analyze, and Automate - all from within SocialBu.

Josh

josh is a home’s best friend. and like a dog, josh is intelligent, responsive, and learns his owner’s commands. while other smart home control systems only know one trick, josh combines all aspects of smart homes into one friendly, well-trained responder. josh is your companion, and always happy to see you come home.

Listnr 2.0

Generate realistic Text to Speech (TTS) audio using our AI Voice Generator with the best synthetic voices. Instantly convert text in to natural-sounding speech and download in MP3 and WAV formats.

Text2Present

Allows you to create creative customized presents using artificial intelligence for your friends, family and acquaintances without taking your precious time. Simply enter a text description of what you want to gift and let our artificial intelligence do the rest.

Plailabs

(verb) – To engage in artificial intelligence for the purpose of enjoyment and recreation with the goal of growing an ever-expanding universe of gaming, entertainment, storytelling, and technology.

Graphic AI

Stork helps teams improve communications and productivity. It is a Business Messenger for Hybrid & Remote Teams that Records and Transcribes All Meetings and Calls automatically. Made for asynchronous post pandemic world and assisted by artificial intelligence.

Virtual Face

Say goodbye to awkward selfies and unflattering angles, and hello to a picture-perfect first impression. Their Artificial Intelligence model analyzes your facial features to create a polished and attractive profile picture. In under 30 mins you can develop the right profile picture by uploading 15 photos to the platform for training and use those pictures wherever required.

Tidb

TiDB Cloud makes deploying, managing, and maintaining your TiDB clusters even simpler with a fully managed cloud instance that you control through an intuitive console. You are able to easily deploy on Amazon Web Services or Google Cloud to quickly build mission-critical applications.

Olvy Changelogs

Olvy dramatically enhanced your in-app release communication to customers in a visually engaging, no-code way. Manage user feedback like never before and build better products with customer feedback

Wordmetrics

Wordmetrics is a sophisticated content creation and optimization platform which leverages artificial intelligence and natural-language processing to tailor your web-content for better search performance. When you enter a search phrase, Wordmetrics' AI analyzes competing webpages currently ranking for that search phrase. Wordmetrics AI analyzes the competition by reading every competing web page to understand the entire "library" of competing content for important semantics.

Booke AI

Fix uncategorized transactions and coding errors, communicate with clients, and automate your work. Use Booke AI to automate month-end close, reduce stress and effortless resolution of uncategorized transactions and coding errors. Spend less time on manual categorization and more time on growing your business with our accurate and reliable auto-categorization feature.

Good Tape

Good Tape is an automatic transcription service that makes it easy for journalists (and others) to turn audio into text, regardless of language or sound quality. We save you time and effort so you can focus on what really matters. You can trust us to safeguard your recordings. They are protected by end-to-end encryption, the files never leave the EU, and we are fully GDPR-compliant.

Jaqnjil

Jaq N Jil is a powerful AI writing tool to make your content writing process faster and better with a load of features like AI Assisted Content Planning, AI Text Expanding & Rewriting, a Massive Stock Image Library, Text & Voice Activated AI Chatbot, and much more in their pro+ version. It also integrates with 5,000+ tools via Zapier. Use the tool for SEO blog articles, Social post captions, Essays and papers, Marketing materials and much more.

Caffeinated Cx

At Caffeinated CX, we’re all about making your customer support more efficient. That’s why we integrated with all support softwares and we’re always open to adding more. Caffeinated CX guarantees to 10x your customer support efficiency or get your money back!

Auri AI

With the Auri AI keyboard, you can write blogs, essays, emails, or anything else, fix your grammar and spelling mistakes, translate your writing to and from over 20 languages, paraphrase your sentences and paragraphs in 10+ different ways, and more. Write faster, smarter, and mistake-free in any app, any language.

Jungle AI

Canopy’s AI uses historical data to learn how your machines function under all operating conditions. They are deployed in various industries, helping to detect failures ahead of time, reduce machine downtime and increase performance. Canopy learns what normal behaviour is and can extrapolate what abnormal is. We don’t train for specific failure types. If the abnormality is in your data, Canopy will find it, no matter the cause.

Poplarml

PoplarML enables the deployment of production-ready, scalable ML systems with minimal engineering effort. Lets you deploy any machine learning model to a fleet of GPUs as a ready-to-use and scalable API endpoint with one command.

Inboxpro

Save time managing your Inbox like a Pro, become an email pro user and concentrate on the important things: your product, your team and your life! Let AI do the hard work, so you can write emails in a matter of seconds and get things done faster by summarizing never ending emails. Avoid sending back-and-forth emails to find the perfect time for a meeting. Just send a link to your calendar or add a button to your email signature. Build automated follow-up sequences with multiple steps and conditions easily and stop wasting your time pursuing your leads manually. Receive notifications when the emails you send are opened or the links are clicked. So you can be aware if the conversation is getting hot and sales are coming. Stop writing and sending the same emails over and over again and start using InboxPro’s templates to make your sales and customer support teams happier. Add a professional and beautiful designed signature to your email with your picture and contact details to make your brand stand out from your competitors.

Genforge

GenChat from GenForge is an artificial intelligence tool that helps users to quickly and efficiently summarize documents, ask detailed questions, and get real-time responses about the detail in the documents. It also has AI chat support and image generation capabilities. It is available for WhatsApp and Slack, with Google Drive integration in early access.

Wizi

Wizi is a code search feature for frontend teams that enables them to instantly search through React (JS/TS) codebases using natural language. It also includes an AI agent that can help with common frontend tasks, such as creating new features, refactoring existing code, migrating files, and updating HTML/CSS. The tool is launching soon and users can reserve a spot to get early access.

Infomail.AI

Infomail is an email marketing platform that uses artificial intelligence to generate texts and translate them into English. Marketing professionals can create and send personalized emails to their customers to improve engagement and conversions. Using it's technology, it's possible to automatically generate email texts, selecting the most appropriate keywords and phrases for the target audience, to increase the effectiveness of email marketing campaigns. Additionally, Infomail provides an automatic translation service into English, enabling businesses to reach a wider audience and increase brand visibility in international markets.

Mindsdb

Apply the power of OpenAI's GPT-3 and Hugging Face models to the text data in your database in just a few SQL lines. Use simple SQL commands to automatically classify & label text columns, create messages, summarize, translate & more!

Clipyboard

Clipy Board is a tool to help manage messages sent by Customer Service. It allows users to configure messages and invite collaborators, giving them complete control over the messages their customer service sends. It can be used in many different ways, such as customer service, managing micro-influencers, and more. Users can create as many buttons and languages as they want, and share them with teams.

Cmd J

Supercharge your productivity by using ChatGPT on any tab without hassle of copy-pasting with our easy-to-use Chrome extension. Improve your writing, generate blog posts and crush coding issues with ChatGPT keyboard shortcut.

Change Style AI

Pictures are memories of moments in your life. Change Style AI uses artificial intelligence to create fun new styles of your pictures while keeping the initial structure. Let your creativity free!

Operand AI

Operand adds extra results to Google by searching through the apps your team uses for work. It's purpose-built for modern, product-focused teams and integrates with software like Linear, Github, Slack, Discord, and Notion.

Getsound

Personalized soundscapes based on current weather conditions. Can be used in places like spas, hotels, resorts, and workspaces. Using 24/7 weather monitoring and physical environment parameters, the app creates soundscapes that are ever-changing and unique to the location. Also offers 20+ soundscapes, such as sunrise, sunset, desert, jungle, ocean, wind, and rain.

Devi

Devi is a productivity tool that saves businesses 60+ hours a month in manually browsing social media. Devi monitors social media posts for brand mentions and important keywords and alert the user for the posts that matters to the business growth and reputation.

Relevance AI

Today’s approach to uncovering customer insights is slow, manual, expensive and inefficient. Relevance AI is the fastest way to analyse customer feedback data at scale. From any source for actionable insights and drill-downs. Today’s approach to uncovering customer insights is slow, manual, expensive and inefficient. With Relevance AI, respond to new business requirements faster and solve your business issues quickly with sharper intel from unstructured data.

Dailybot

DailyBot now has a vast amount of knowledge and can provide accurate and helpful answers to a wide range of questions without you leaving the chat. They use a robust AI tech stack to analyze data, allowing the bot to provide prompt and concise responses to users. DailyBot's friendly and approachable personality makes it easy for users to interact with it and feel comfortable asking for assistance in their daily work.

AIcogni

AiCogni is an advanced AI chatbot and writing assistant app that is powered by ChatGPT technology. Its simple and intuitive interface, as well as its support for voice interaction and WearOS, make it accessible and user-friendly. AiCogni can understand multiple languages and help with various tasks, such as answering questions, generating ideas, and improving writing quality.

Virtuoso Qa

Virtuoso is a Codeless robotic test automation platform that speeds testing 10x by empowering engineers and non-engineers to create self-maintaining automation in the cloud. Virtuoso supercharges QA for any browser-based enterprise and custom applications by automating UI, UX, Functional, Integration, Visual, Compatibility, Accessibility and security testing.

Norby AI

Norby AI was founded in 2020 and is based in Tallinn, Estonia. We are a team of enthusiasts who develop Smart solutions for businesses that care about their customers. Customer service can be exhausting and expensive with all the routines it creates in the modern world. We are here to enhance your support and sales teams' efficiency by handling this routine with AI-powered technologies. We want to make this solution affordable and easy to use even for small businesses.

Attention

Attention is a real-time, fully integrated voice assistant for sales teams that helps them to close deals faster. It provides actionable intelligence to sales reps during their calls, automatically fills up CRM fields with one click, and drafts personalized follow-up emails with AI. It also integrates with popular tools like Zoom, Salesforce, Hubspot, Gmail, Outlook, Slack, and Zapier. 100+ sales teams have already benefitted from Attention.

Maigon.Io

Maigon solutions include document-specific contract review modules as well as contract type-agnostic API. All of Maigon products integrate the latest deep learning technology to ensure maximum accuracy and efficiency.

Kwirk

Kwirk is a cutting-edge office program that offers a suite of improved productivity tools supported by AI. It has an effective summary tool that can quickly offer a succinct and thorough summary of any text. Also provides a personal AI coach who offers real-time feedback on your text and a logical block-based document management system. There are translation services included as well and it supports all file types and languages.

Gamma.AI

Gamma.AI developed an AI-powered cloud DLP that could connect across all cloud collaboration applications in one click, prepackaged with out-of-the-box ML-powered data classification profiles and offering the industry's best data detection

Delibr

Harness the endless potential of AI. Supercharge your productivity with guidance and help writing. Features include dynamic templates, writing help, feedback revision and writeups. AI tool for product and project managers

Jusi

Jusi is an AI-powered tool that enables businesses to bring their ideas to life faster and more affordably than ever before. With its advanced GPT-3 technology, Jusi can generate and search for new ideas. With Jusi, businesses can access the power of AI to develop their ideas faster and more efficiently, giving them the competitive edge they need to succeed.

Smodin

Everyday applications used by millions of students, writers, and internet workers across the globe including a text rewriter, plagiarism checker, auto citation machine, and a multi-lingual translator. Enhance your writing with Smodin.

Textbuddy

Textbuddy is a text editor tool that helps writers create clear content in plain language. It finds phrases and words that are vague, passive, or complex, as well as pointing out too long sentences to help users write in a polished, yet understandable, manner. With its GPT-3-powered AI assistant, writers get access to AI copywriting, as well as synonyms, grammar and spelling checks, and sentiment analysis

Promptloop

PromptLoop is a spreadsheet formula that enables users to transform, extract, or summarize any text using AI models. It is designed to be used in Google Sheets and Excel, and can generate answers with powerful AI models. It can be used to analyze sales lists, generate keywords and SEO content, unpack survey responses, draft emails and outreach, and transform messy text.

Shortwave

A tool that respects your time and privacy, and uses the latest technology to make managing your communications effortless and efficient. With Shortwave, email may not even feel like email to you.

Qikpm

QikPM generates comprehensive user stories from simple user story input and app description. Use the tool to effectively write user stories for developers. Highlight the AI-powered capability of the app to generate user stories with just a few clicks, saving time and effort for product managers. The app offers 50 free user stories every month to help spark your creativity and drive your product vision.

Lavo AI

Lavo Life Sciences is a VC-backed, early-stage startup developing software tools for drug development. We're a team of chemists and engineers developing novel techniques to solve industry challenges.

Level AI

Level AI is the next-level contact center intelligence platform. Our AI-first SaaS helps companies uncover customer insights and drive business outcomes. Level AI enables omnichannel optimization by analyzing customer experience, assisting agent performance, and automating contact center operations.

Missive

Get more done with Missive, the email collaboration & management tool for productive teams now supercharged by AI. The OpenAI integration allows for quick drafting, replying, translating & more! Plus, use your own token & pay only for what you need.

Deepagency

Deep Agency offers virtual photo studio services with advanced AI technology for professional photos without leaving home. Using Deep Agency you can hire virtual models and create a virtual twin with an avatar that looks just like you. Just Upload a few selfies and get an AI generated clone in seconds for your personal photo shoots.

Monica

Monica is a chrome extension powered by ChatGPT API, designed to be your personal AI assistant for effortless chatting and copywriting. Simply hit Cmd+M or Ctrl+M and start chatting with her. Or let Monica help you compose and insert text into any web page. Choose from over 80 templates to quickly generate marketing copy. Select a text in web page and let Monica explain, translate, rephrase for you.

Toucan

Toucan is a comprehensive AI Writer & Chatbot that offers a wide range of features to help create unique, human-like responses quickly and easily. It is suitable for a variety of tasks, including creative writing, marketing copy, data analysis, and more.

Freeday.AI

Europe’s leading digital staffing platform. The name Freeday comes from the idea that everyone should be free on Friday. It's an explanation with a wink, but we take it seriously. Here you can outsource boring repetitive tasks to our digital employees. Freeday helps teams build their own digital workforce to fully unlock their creative and productive capacities, leading to improved experiences and revenues

AIPRM for ChatGPT

1-Click Prompts for ChatGPT! AIPRM for ChatGPT adds a list of curated prompt templates for SEO, SaaS and more to ChatGPT. Try today. New release 0.1.3.3 with UX Improvements and new community at https://forum.aiprm.com/ Are you looking for a quick and easy way to improve your website's search engine optimization? Your Marketing? Your Sales and Support? Look no further than the AIPRM Prompts for ChatGPT browser extension! With just one click, you can access a curated selection of ChatGPT prompts designed explicitly for a list of curated prompt templates for SEO, SaaS, Marketing, Art, Programming and more in ChatGPT. See what well-known SEO experts say: https://twitter.com/aleyda/status/1612071976654225408 https://twitter.com/CyrusShepard/status/1612527463300730880 https://twitter.com/DataChaz/status/1612127135329656836 and too many more to list. These prompts will help you optimize your website and boost its ranking on search engines. Don't waste any more time struggling to engineer the perfect prompts - let the AIPRM ChatGPT Prompts for SEO extension do the work for you! Now, you can save your prompt templates for your use or share them with the community for all to benefit from. As a prompt template author, your name and a link will be very prominently displayed next to the prompt, giving you the opportunity for clicks and recognition. In this update, you will get the following: - Improved prompts, even the "Outrank Article" should work in all languages now! - Categories for Prompt - Filtering & searching for Prompts - Save your Prompts - Share your Prompts with the world - Edit Your Prompts - Delete Your Prompts - Vote on Prompts others shared - Find the most popular Prompts others shared - See your name and link for the Prompts you shared. - Report back issues with Prompts - Export full chat conversation So yes, Popular Prompts should get a lot of clicks. Prompt engineers, don't miss out on the opportunity to gain recognition and clicks as a prompt template author. Share your templates with the community now. Watch this tutorial video to learn how to create your own prompts https://www.youtube.com/watch?v=udH9HpJX4cc Please note: it is AIPRM, not AIRPRM or AIRPM as some people type in. New release 0.1.3.3 with UX Improvements and new community at https://forum.aiprm.com/ AIPRM doesn't support or endorse the use of other ChatGPT extensions in parallel to AIPRM.

Brandmate AI

Brandmate AI is an advanced brand content management tool designed to help local business owners manage their online reputation, social media presence, and customer engagement. The platform leverages cutting-edge AI technologies to automate sentiment analysis, generate AI-powered review responses, and create engaging social media content. With Brandmate AI, businesses can easily sync their latest reviews from Google and other platforms, respond to customers with customized responses, and improve their online reputation. The platform also includes powerful business tools for email replies, product or service documentation, and business letter generation, making it a comprehensive solution for all brand management needs.

Mailr

Use the power of artificial intelligence and reply to any email. Give Mailr the intention (goal of your email) in a few words and choose from 10+ custom tones (ex. friendly, informal, persuasive, etc.)

AI Sofiya

Say hello to Ai Sofiya - the ultimate AI-powered tool for effortless content creation that revolutionizes the way you create social media AI ad copy, Text-To-Speech conversion online, and beyond. With advanced text generation and state-of-the-art text-to-speech technology, Ai Sofiya empowers you to craft compelling Google ads, articles, and blog posts within minutes. No more creative blocks, no more wasted time. Ai Sofiya unleashes your productivity potential and sets you up for success. Embrace the limitless potential of AI and elevate your content creation game to new heights. The future of content creation is here - join Ai Sofiya today!

Whimsical AI

Whimsical uses AI-powered suggestions to help brainstormers break through creative blockages and come up with new ideas. Users are able to level-up their workflow and generate ideas, Whimsical offers tools like mind maps, wireframes, flowcharts, projects, documentation, templates, embed kit, and more.

Xata

Xata is a serverless data platform that simplifies the way developers work with data. It features a spreadsheet-like UI that makes it easy to review and edit data, a simple API call to answer questions using data as context, and the ability to tune the search experience by configuring column weights and value boosters. It also has a generous free tier with up to 750K records and 15GB for free, with OpenAI API calls included.

Voicetype

VoiceType is a Chrome browser extension that appears when you hit Compose or Reply in your Gmail. When you click on VoiceType, it activates the microphone and you can describe, fluently or not, what would you like to write or reply. You can take your time. You don't have to use any specific words or phrases. Email with that intention

Audyo

Edit words not waveforms, switch speakers, and tweak pronunciations with phonetics. No mic, no studio, just human-quality audio in minutes that's ready to download, upload, and share anywhere and everywhere. Get started today for free.

Hirepeople

Our Chrome extension crafts outreach messages for candidates in no time based on their LinkedIn profile. It allows you to choose the language you want for your outreach messages, indicate your level of intimacy with the candidate and tone up things - choose between a professional or a funny tone of voice for your outreach messages.

Mixpeek

Mixpeek is an intelligence layer on top of your object store like S3. Using NLP, it grants you an “understanding” of your non-text files with just a GET /search API call. You can set it up with a single line of code.

AI Word Guru

Their platform offers a range of services that can assist you in crafting the perfect letter, blog, email, video description, interview questions, social media posts, Google ad descriptions, cover letters, business ideas, and much more. At AI Word Guru, we believe that writing is an art form that should be accessible to everyone, regardless of their skill level or writing experience. That's why we have developed a platform that makes the writing process more accessible, efficient, and enjoyable.

Luminal

Luminal helps you tame large, messy spreadsheets using GPT3. All you need to do is show Luminal how the data should look and upload your spreadsheet. Luminal dynamically writes a Python script behind the scenes that does the cleaning for you. Get your customer's spreadsheets ready for processing faster than ever before

Postalai

PostalAI - the perfect way to add a touch of art and personalization to your messages. Our platform allows you to generate beautiful postcards with AI-generated art and custom messages, which can be mailed anywhere.

Solidgrids

SolidGrids is an AI-powered platform that offers a solution to slow and costly image post-production processes in e-commerce. With SolidGrids, you can generate marketable images in seconds, saving time and resources. The fully automated platform offers seamless integration options to suit your specific needs. It is faster and more cost effective than traditional image post-production methods, providing e-commerce businesses with an efficient and affordable solution. Start using SolidGrids for free today and experience the benefits of AI-powered automation for yourself.

Intelligent Paraphraser

AISEO is the ultimate solution for anyone looking to supercharge their writing skills. With cutting-edge artificial intelligence technology, AISEO makes it easier than ever to convert your ideas into compelling, well-written blogs. Simply input your thoughts and let AISEO do the rest. With a single click, AISEO will produce high-quality, SEO-optimized content that engages and informs your audience. Whether you're a busy professional looking to save time, or someone seeking to improve your writing abilities, AISEO is the perfect tool for you.

Mgrworkbench.AI

Use the phenomenal power of Artificial Intelligence (AI) to speed and simplify some of your most onerous business-writing tasks, to help you effortlessly draft your employee performance reviews, development plans, and business letters.

Landing.AI

Landing AI is pioneering the Data-Centric AI movement in which companies with limited data sets can realize the business value of AI and move AI projects from proof-of-concept to full-scale production. LandingLens, Landing AI’s flagship product, makes computer vision easy for everyone.

Wrytr AI

With Wrytr AI, you can create compelling blog posts, engaging social media content, and even product descriptions in a fraction of the time it would take to do it manually. Plus, the software is constantly learning and adapting to your unique style and preferences, ensuring that every piece of content is consistent and on-brand. It's perfect for businesses of all sizes, from startups to established companies looking to streamline their content creation process.

Verbatik

Generate Realistic Text to Speech (TTS) audio using AI Voice Generator and best synthetic voices. Instantly convert text in to natural-sounding speech and download as MP3 and WAV audio files. Choose from a growing library of over 600+ natural sounding voices with humanlike intonation in 142 languages and accents powered by advanced machine learning technology.

Coverlettersimple.AI

CoverLetterSimple.ai makes it simple for users to write cover letters tailored to particular jobs. Users can enter a job title and description, and the application will use artificial intelligence (AI) to analyse the information and create a custom cover letter for them. The end result is a superior cover letter that is customised for the opening. Users who use it stand out from the crowd and land more job interviews.

Blog Booster

AI will generate a list of subjects dedicated to your blog and then write an article several times a month and automatically publish it on your website. Thanks to this you will gain SEO booster for your website. Cyclical adding content on website works perfect for SEO. Thanks to our texts you will gain more traffic to your website and this will result in more sales.

Ask String

String is a suite of analytic tools that listens and understands. It takes initiatives rather than just taking orders. It goes beyond understanding structured data and can comprehend the nuances of unstructured data. Data analytics is charting a course through uncharted waters, and STRING is the captain of that journey. We’re sailing into a brave new world of exploration, where systems of understanding and intelligent collaboration lie waiting to be discovered.

Userdoc

Innovative modern requirements management tool that helps organize, manage, and analyze requirements of large-scale technical systems. It offers features such as AI assistance, collaboration, and integration with other systems, as well as user stories, personas, and user journeys.

Juice

Juice allows GPUs to become fully network attached. Scale up and down your development with no setup time and no commitment to the underlying machine or stack - just connect to a GPU as if it was plugged into your PCIe slot directly. Bare-metal performance on both graphical and ML tasks over **standard networking**! Take advantage of GPU's natural load-balancing telemetry and make GPUs sharable across multiple clients and tasks.

AIdaptive

Increase conversions and revenue with AI-powered personalization for the entire buyer journey. Connect your data to start personalizing instantly, including to new anonymous visitors based on real-time behavior and similarities to current customers.

Content At Scale

Need to produce SEO-optimized content at scale? Our AI takes what is already working based on top ranking content for your target keywords, then writes completely fresh content modeled off of that. You no longer need to worry if a writer has experience in a given industry, no need to pass down knowledge of your existing content to new writers, and no more trying AI content tools that lack quality, take up time, and can be detected as AI content.

Myreport

MyReport receives your question and our augmented intelligence surveys the Internet World collecting and filtering valid data related to your request. Learning from those sources will allow it to summarize and elaborate the found contents to generate a beautiful document, including source citations, as we are totally against plagiarism.

GPT Hotline

Bring the power of the model behind ChatGPT to WhatsApp. No apps or bookmarks needed. Experience the future of communication with the world's most advanced chatbot on your favorite messaging app.

Levity

Levity empowers non-technical users to create an AI model to classify text, images, and documents, and automate their daily work. Raise your productivity while saving time and brain space on manual and tedious tasks. Plug and play with ready-to-use flow templates or build a custom model by training the AI with your own data. You will be able to automate: the labeling of interested prospects in outbound email responses, customer support ticketing routing, content moderation, categorizing your product inventory, analyze survey responses, and more!

Ask Poppy

Meet Poppy - your bestie that actually texts back. Poppy meets you where you are. Whether you’re thinking, trying, pregnant, or postpartum, she's the friend you need, when you need her.

Pinecone

Pinecone makes it fast and easy to take vector search from research to production, without DevOps. Once you have vector embeddings, manage and search through them in Pinecone to power semantic search, recommenders, and other applications that rely on relevant information retrieval.

Right Blogger

Go from zero to published faster than ever with AI-powered writing tools. Get inspired with content to start your blog posts, identify new keyword opportunities and outperform your competitors

Hair By AI

We're on a mission to empower women with hairstyle recommendations that are unique to their preferences. We want to remove the uncertainty of choosing the wrong hairstyle and give beauticians better guidance on how their clients want their hair configured.

Trade Foresight

Trade Foresight is world's first AI-based trade platform that can help you take your business to the next level. The platform provides access to reach 23 million global businesses, Connect with trading partners worldwide, 60% cost savings vs. other B2B platforms, Accurate data for smart decisions, Multilingual support and virtual meetings

Intellimize

Intellimize is a cookieless, no code, AI-powered programmatic CRO platform that enables companies to get the most out of their website by converting more of their traffic into results they care about like more revenue, more customers, and more leads to sales. Intellimize powers high converting websites by combining advanced machine learning and marketers' creative ideas to optimize website experiences for each unique visitor every time, even on first page view for anonymized visitors. Conversion-obsessed marketers at Gong, Mercari, Tableau, Okta, Dermalogica, Drift, Sumo Logic, SingleCare, Live Conscious, and more use Intellimize to ensure no ad dollar is wasted.

Summon

Summonistheultimatecollaborativeinterfacedesigntoolforteams.WithSummon,youcancreatebeautifuldesigns,prototypes,andgatherfeedbackinoneplace.It'stheperfecttoolforteamsofanysizetocometogetherandcreateamazingproducts.Summon'sintuitiveanduser-friendlyinterfacemakesiteasytogetstarted,nomatteryourdesign[…]

Embra

Your personal, intelligent AI — always one second away! Embra can pull in contextual data from Chrome and other apps to speed up and unlock creativity across Q&A, brainstorming, writing, reading, and coding.

Censius

Censius is an AI Observability Platform that helps organizations of all scales confidently make their machine learning models work in production. The company launched its flagship AI observability platform that helps bring accountability and explainability to data science projects. A comprehensive ML monitoring solution helps proactively monitor entire ML pipelines to detect and fix ML issues such as drift, skew, data integrity, and data quality issues.

Cogram

This tool automatically takes notes and identifies action items, and can sync key information to your CRM. It also provides summaries and exports of meetings in real time. It has enterprise-level security, with multi-factor authentication and state-of-the-art encryption for maximum security. It also ensures privacy with no audio or video recordings stored. It integrates with Microsoft Teams, Google Meet, Zoom and more. Try it for free and see the benefits for yourself.

Tweet Monk

AI-powered Twitter thread editor that makes writing threads for Twitter fun and easy. They've made it easy to automate and grow your twitter accounts with Tweetmonk. All the tools you need are accessible at your fingertips.

5-Out

5-Out automatically ingests data from internal (POS, labor scheduling, reservations, events) and external (weather, traffic, events) sources and uses next-gen machine learning to accurately predict upcoming sales (revenue, covers/guests, items), and provides guidance on labor scheduling and purchasing budgets.

Evoke

Evoke allows devs and businesses building AI apps to avoid expensive cloud setup by hosting AI models on the cloud that are accessible through APIs. Our stable diffusion API allows users to create AI generated images for their AI apps without cloud setup.

Darrow AI

Darrow's AI-Powered Justice Intelligence Platform scans real world data to detect harmful events, determine the number of victims, predict the legislative outcome, and assess the financial value of a case. Top litigators partner with Darrow to access high-value, meritorious cases.

Quadency

Say goodbye to confusing menus, endless dropdowns, and trading limitations of any kind. Tell Cody, the trading bot, your strategy. Cody trades. Instruct Cody in plain English, just like a regular chat. Trade technical indicators, price action or events. Cody executes the trade for you, so you don’t have to.

Stealthgpt

Our proprietary filter allows users to submit prompts and receive response back from GPT3 in a unique manner that is very difficult to detect. We are working on several different usecases, involving long form content creation as well as narrowed tasks in addition to currently allowing users to submit prompts. Our focus will be on maintaining user privacy so that if they choose to use AI technology that is their personal business and discretion.

Laxis

Laxis captures conversations intelligently to make your meetings more productive and enjoyable. Simple transcription and personalized templates help you extract insights, action items, and key quotes from (and across!) meetings.

Bilfrost

Bifrost is a tool that can help turn Figma designs into React code automatically. With this tool, designers can create and update screens in Figma without the need for manual handoffs, and engineers can focus on features that drive the business forward instead of having to create screens and components. Bifrost works by converting the Figma design into clean code that can be dropped into Visual Studio Code, and any design updates can be shipped without engineering hours.

Neuroflash

Accelerate content creation at scale with the highest-quality AI-generated marketing texts & never stare at a blank page again. Make the best content decisions and get a quantitative measure of your content impact before publishing your next campaign. We offer over 100+ text-types, including our command feature in order to speak directly to the AI.

Lebesgue

Lebesgue is your AI CMO, providing comprehensive marketing analysis and optimization to help you achieve your goals. By analyzing global marketing trends, tracking your competitors, and monitoring your business metrics, Lebesgue offers a full view of the market and helps you stay ahead of the competition. With in-depth competitors intelligence and market benchmarks, Lebesgue enables you to make informed decisions and stay up-to-date with the latest trends. Moreover, Lebesgue offers lifetime value analysis to optimize your customer acquisition strategies and maximize your returns. Its AI copywriter provides personalized content based on your competitors' ads and what works in advertising, ensuring your messages resonate with your audience and drive conversions.

Chatwp

AI chatbot that gives direct answers to your WordPress questions, trained on all the official WordPress documentation. They built a webcrawler to scrape all official documentation from the WordPress.org website. This includes the "Learn WordPress" tutorials and lesson plans, all articles on the "Documentation" pages (wordpress.org/documentation/), and the entire "Developer" site (developer.wordpress.org) with code references, handbooks, and commands. It is also allowed to use general knowledge about WordPress learned from the Internet with restrictions.

Storyd

STORYD is a tool that helps users create AI-powered data presentations that are engaging and impactful. It enables users to quickly create presentations that will capture the attention of leaders, helping them get recognized for their hard work.

Postwise

AI Twitter tool to help users go viral on Twitter. Features tools to write, schedule and grow on Twitter with ease. Also provides helpdesk and tutorials to help users write better tweets threads using AI.

Markopolo

A first-party data-based marketing stack, powered by MarkTag that can recapture lost audience across platforms due to cookie loss, ensuring a direct lift in Revenue. Currently, we are supporting omnichannel campaigns on Facebook, Instagram, Google, YouTube, TikTok, and Linkedin. Perform optimizations to increase sales while lowering costs and Automate daily actions to focus on strategy.

Simple Phones

Forward your missed calls, or get a new number, and Simple Phones will answer it using AI. You'll get a phone agent created for your business for free. You just pay 19¢/min for any incoming calls, and you decide how much to pre-load your account with.

Linguix

Linguix is an AI writing assistant and grammar checker for content creators and business professionals. Their Chrome extension offers you sentence rephrasing and checks grammar online in real time on millions of websites used by marketers, salespeople, customer support reps, and HR professionals. The writing assistant seamlessly integrates with Asana, Google Drive, Gmail, HubSpot, and other business platforms to improve your writing style stress-free.

Whelp

Whelp is an AI-powered omnichannel customer service automation tool that serves a wide range of features to cover all sides of customer service processes for SMEs. You can serve your customers 24/7 without any human interaction. ChatGPT, Google AI and Amazon Lex are also integrated for better results.

Sloyd

A 3D modelling platform that simplifies the process of creating 3D models. It has a vast library of generators that can be used to create any 3D model, and these models can be quickly customized to fit the user's style. The models are also UV-unwrapped and optimized for real-time use. Sloyd also offers an SDK for real-time generation within game engines. There are also FAQs, a Discord server and other help and support resources.

Powerpresent AI

Powerpresent AI is an automated presentation-creating tool that allows users to quickly and easily generate visually appealing presentations. It uses AI technology to automatically generate professional presentations from topics or text that users input. It also allows users to select art styles to enhance their presentations. The presentations can be exported to Google Slides or downloaded as a PPTX file for easy editing.

Mightygpt

MightyGPT is an AI-driven virtual assistant that helps people tackle mundane, repetitive tasks in businesses and organizations. The platform uses natural language processing, machine learning, and artificial intelligence to automate and manage processes quickly and accurately, And provides this service on WhatsaApp.

Lunit

Lunit is a public company that develops medical AI software that helps conquer cancer. With cancer, survival is often determined by how early it is caught, and Lunit’s cancer screening AI helps doctors to detect it earlier. Lunit INSIGHT can detect abnormal radiological results with up to 97-99% accuracy on chest x-rays. Many of these abnormalities are invisible to the human eye and would be missed by doctors without Lunit’s help. Lunit SCOPE uses AI to predict treatment responses to help doctors make well-informed decisions about how to treat a patient.

GPT-Me

IntroducingGPT-Me–therevolutionaryAI-poweredwebappthatneverstopslearning!Whetheryou'relookingforself-discoveryorjustsomemindlessfun,GPT-Meistheperfecttoolforyou.Simplychatwithit,andit'llrevealsomeamazinginsightsaboutyourselfthatyouprobablyneverevenknewexisted.Andthebestpart?Themoreyou[…]

Publer AI Assist

Visual content is a key factor in the success of your social media pages, but creating it can be time-consuming and overwhelming. AI Assist takes the hassle out of photo creation by generating stunning, high-quality images that are perfectly suited for your brand and style.

Flowshot

Flowshot is the all-in-one AI toolkit that integrates with the workflows of 2 billion Google Sheets users. Now, anybody can become a power user with a range of powerful, easy to use AI models — without any technical knowledge or setup.

Peachly AI

Peachly AI is an all-in-one AI advertising solution that helps businesses create, target, and optimize their Facebook, Instagram and Google Ads campaigns. With cutting-edge AI image technology, precise targeting accuracy and advanced algorithms, Peachly AI maximizes advertisement return on investment. It offers an affordable pricing structure starting from $49, and customers can try their 7-day trial for free. Human experts oversee each campaign for maximum performance and ensure that campaigns are error-free.

AIbert

A WhatsApp Bot that does the work for you! Get instant results with ChatGPT and MidJourney images. With no additional software to install, the AiBERT Bot is getting smarter every day and is safe with end-to-end encryption. Get instant replies right in your WhatsApp inbox.

Brandbastion Lite

Easily monitor and manage all your social media conversations with BrandBastion Lite! Our AI simplifies comment management by analyzing sentiment, detecting spam and hate speech, and identifying the messages that require a response from your brand.

Vowel AI

Automated meeting summaries. Use the power of AI to save time and keep everyone on the same page — minus the manual work. They also have additional features where you can react with emojis, send text messages or bookmark a moment.

Blubi.AI

Build interactive AI-driven chatbots on top of your content and give your audience a taste of interactive learning. blubi helps you to increase engagement, make the content interactive and showcase value in a immersive way.

Zeemo

Zeemo is an application that empowers content creators to auto-generate and translate video captions in 17 languages with a state-of-the-art accuracy rate. Try the best captioning tool for talking videos right now!

Oscar – Bedtime Story Generator

Oscar allows parents to generate personalized bedtime stories for kids with the help of artificial intelligence. The app utilizes cutting-edge AI technology to create unique and engaging stories that are tailored to the user's preferences. With Oscar, you can experience the thrill of reading a new story every night without having to spend hours searching for the perfect one.

Coverler

Coverler creates unique cover letters for every job you apply to in minutes. Just provide your skills, experience and job details – and get the perfect cover letter. Our AI-powered tool finds and highlights your skills & experience that match job requirements, and proves that you are the perfect candidate. So you don’t waste time editing letters to every role, get more interviews and land your dream job in a breeze.

Castmagic

Castmagic is the fastest way to turn podcast audio into ready to use content using AI. Upload your mp3 and instantly get: - Summaries, bios, key topics & chapter breakdowns - Meaningful quotes, hooks & timestamps - Ready-to-post blog and social content

Emailmagic.AI

EmailMagic uses AI to help users write emails 10x faster. There are two subscription plans available - Basic and Premium - and a 7-day free trial for both. The Basic plan offers 10 emails per day, medium copy originality and support for English, Spanish, and German. The Premium plan offers 100 emails per day, with high copy originality, support for all languages and early access to new features.

Connected Papers

Getting a visual overview of a field of research. You will be able to see at a glance which papers are most popular in the field, as well as the various dynamics between areas of study. Making sure you haven’t missed a key paper. This is especially useful in fields that constantly produce a large volume of new papers. Exploring relevant papers in a bi-directional manner. Connected Papers lets you discover the most important prior and derivative work in your area of interest.

AI Majic

Instantly write Video Descriptions, Youtube Tags Generator, Social Media Posts, Article Generator, Talking Points, Summarize Text, Startup Name Generator, and generate one of most effective copywriting formulas for your business!

Artsmart.AI

Artsmart.ai brings many of the fragmented ai use cases into one tool from ai art image generation playground to ai avatars and ai portraits. Leverage of the power of AI trained on the worlds best artists to generate images for fun and business

Inktee AI

Using advanced generative AI technology, customers can create custom t-shirt designs by simply describing the image they want. Each t-shirt is then printed on demand, ensuring a high-quality, one-of-a-kind product every time.

Tabletalk

Utilize artificial intelligence to better map out your database in a way that feels like you're talking to a human. It's a natural language interface that allows you to ask questions about your database and get answers back in a way that feels familiar.

Stride

Stride's AI technology scans social media platforms daily to identify new followers and find their email addresses. It implements advanced monitoring algorithms to analyze social media accounts and extract the email addresses of the newest followers, thereby enabling efficient and relevant email leads, also by using a combination of methods, including behavioral analysis, IP address analysis, social network analysis, and content analysis, to accurately identify and filter out bot accounts. This helps to ensure the accuracy and trustworthiness of your data.

Dreamstaging.AI

Unlock Endless Design Possibilities with Artificial Intelligence: AI-Generated Interiors in Minutes for Your Listings and Design Projects. Upload a photo of an empty room and get dozens of professionally designed and furnished interior variations in minutes, across various styles and room types. AI-powered virtual staging can save you a lot of time by automating the process of creating virtual staging designs and allowing you to focus on other aspects of your business

Entar.Io

Save 5x time with AI-generated replies for social media (LinkedIn, Twitter, Facebook, etc.). Let Entario create comments tailored to each inquiry in seconds. Customize and edit comments in different tones of voice. Works with all major social media platforms.

Sybill

Sybill generates accurate, human-like sales call summaries based on the conversation and the buyer's emotional reactions. Follow up effectively, hit on the precise areas of interest, and say goodbye to taking notes for CRM.

Avatarify

Create personalized avatars using artificial intelligence. Their technology allows you to generate lifelike representations of people, animals, and even fictional characters. Just pay for the GPUs you rent. If you don't like it, they re-render the avatars.

Anybot

AnyBot is an online platform that lets you create AI-powered bots to handle customer interactions for any use case. With our easy-to-use interface and powerful OpenAI GPT-3 technology, you can customize your bot's personality and instructions to provide an engaging and personalized experience for your customers. Try AnyBot today and take your customer interactions to the next level!

Podium

Easily generate transcripts, chapters, shownotes, clips, and more with a drag-n-drop interface. Podcast transcripts, highlights, and chapters aren’t just for the big podcasts—now, they’re for everybody.

Nsfw Checker

Stable Diffusion includes a (poorly-documented) safety checker. With a few changes, it can be used with arbitrary images, not just AI-generated ones. It takes a few minutes to finish checking the image.

Gemoo

Capture you and your screen to clarify your points. Take and beautify screenshots you need for any usage. Create an expressive document combining text, videos, images, and audio. Get all files organized visually in Mind Map, Calendar, or Slide view, and send them out via a link to boost your communication. Never get yourself, teammates, or clients lost in cluttered messages.

Notability.AI

Notability organises your notes on Notion, just send them on Telegram, Create a Notion integration, Send it to the telegram bot and then you can simply send your notes for notability to organize them.

Nextthreebooks

We are a book recommendation website that uses GPT-3 to provide personalized book suggestions to our users. Are you wondering what book to read next? Look no further! We offer a variety of book recommendations that cater to your individual reading preferences. At NextThreeBooks.com, we understand that choosing the right book can be overwhelming, especially with so many options available. Our goal is to simplify the process and help you discover your next favorite read.

Voiceful.Io

A website that can generate AI speech, AI singing and AI voice morphing from the text. They have products like Cloud API and SDK. Voiceful.io AI can generate singing and speech between two languages: English and Spanish. In voice morphing, the users can select above 10~20 voices for morphing their voices.

Enzyme

Enzyme empowers the masses to launch in web3 with all-in-one platform to discover, deploy and manage smart contracts and no technical knowledge required. On the platform you can: 1. **Discover:** Hundreds of pre-built and securely audited smart contracts for pretty much anything, ready to be deployed instantly. 2. **Deploy:** No blockchain experience required to deploy on-chain. Currently supporting Ethereum and Polygon. 3. **Manage:** Manage every aspect of your smart contracts effortlessly. Even the imported ones. Public and private shareable dashboards available. You can also import your contract to the platform and manage it from here, build and ship no-code customizable salespages for your digital collectibles or simply embed a minting button to your own website in seconds. It’s free to start - deploy or import up to 2 smart contracts. We offer two paid plans to cover your next big web3 projects with tons of additional features. If any of you end up building web3 using Enzyme or you’re curious to check it out - feel free to join our discord or hit us for support at [email protected]

Post AI

Transform the way you create content with our AI platform. Say goodbye to writer's block and hello to endless possibilities. Experience a new level of efficiency and creativity. Let's bring your ideas to life!

Magical

Magical's AI Meeting Builder is a powerful suite of three tools built on the latest advanced generative AI to fully automate the meeting process. Users can use the tools to optimize their meeting experience during the meeting planning, management, and follow-up phases. AI Agenda automatically generates agendas tailored to your meeting's topics and goals. AI Time Suggest finds the ideal meeting times based on your preferences and availability. AI Notetaker sends a transcribed summary that covers all of the key points and action items from your meetings.

Petals

Open source tool for running large language models like BLOOM-176B collaboratively — you load a small part of the model, then team up with people serving the other parts to run inference or fine-tuning.

Stableboost

Upload a few photos of yourself, a loved one, a pet, a product, or a style you like, and we will automatically train an AI model to generate portraits of you in hundreds of different styles.

Alpharesearch

AlphaResearch provides an unparalleled AI-powered search engine for everything text. We scan through millions of global filings, transcripts, press releases and reports to find the exact insights that you are looking for. We apply Machine learning and NLP techniques to extract insights from texts and traditional fundamental data to save you hundreds of hours of research and understand what executives and market think about the future of the company.

Theloops

You can’t fix what you can’t see….unless you have TheLoops. TheLoops is a CX operations platform that uses AI to empower Support and Success leaders with real-time customer, agent and product insights, providing an instant view of revenue status & explicit customer behavior–no data team required.

Olli

Olli is a company that creates tools to help teams access the power of data. Their products make data work as easy as talking to a colleague, allowing users to quickly and easily extract insights and save time. They have the vision of making data accessible to everyone and are supported by major investors.

Verb.AI

Verb is an AI-enhanced, story-centred, and writer-focused tool for authors of fiction. Beyond text generation, Verb offers support for all aspects of the writing process including planning, writing, reviewing, obtaining feedback, and revising. Like the best editors, Verb helps you plan, write and critique your work. Use it to get your ideas into words – with more pleasure, less pain.

Tweetme

The AI Tweet writer that writes like you. Their AI is trained on your own tweets (as well as GPT-3). You need to connect to Twitter & OpenAI, Generate your tweets and then just push it straight to Twitter.

Chartai

ChartAI is the first AI driven diagramming application that helps professionals making diagrams and charts in 2 seconds with AI. Simply input your diagram requirements, and let ChartAI do the rest. Within minutes, you'll have professional-looking diagrams or charts that are ready to use.

Unschooler.Me

Unschooler is AI-powered, personalized video courses that you can interact with and get feedback on. You can literally talk to videos, add any information, and submit assignments to get feedback from an AI mentor. How it works: ✦ Identify interests and skills ✦ Choose a career goal ✦ Learn everything you need to know with project-based video courses.

Mymind

You can save images, links, notes, videos, quotes, PDFs, articles - anything you want to remember. From the web, your computer or your phone.Your own personal space. MyMind loves beautiful, simple design that considers how you naturally think and work. We’d rather you spend less time with tools and more time doing what makes you happy. And remember, it's all private. Nobody will see what's on your mind.

Outboundify

Stop sending generic, impersonal emails that get lost in the inbox. Our finetuned models analyze and learns from sales data, to identify the best leads and create targeted, highly-effective outreach campaigns.

Steamship

Steamship is a low-code library that allows you to build and deploy AI Prompt APIs quickly. You can install the Python library, customize their API with a few lines of code, and deploy and share it with a single command. They offer free plans with a limit of 500 API calls and 200,000 characters / 40 MB of plugin (LLM) usage, as well as support and debugging help.

Rose AI

A cloud data platform designed to help users find, engage, visualize and share data. Enables integration of external and internal data. Also provides infrastructure tools to clean, analyze, and visualize data in their web application and a data marketplace to preview, buy, and sell data

Celebrity Voice Changer AI

Celebrity Voice Changer AI is an application that changes your voice to the voice of the celebrity you want or uses your text to create speech using AI technology. Our AI technology will swap your voice for the celebrity of your choice in the most realistic way possible!

Remini

Remini uses innovative, state-of-the-art AI technology to transform your old photos and videos into HD masterpieces. The technology detects all the facial details and reconstructs them with a stunning degree of sharpness and accuracy. With Remini you can make all types of images up to 2x bigger. From photos to drawings, paintings to digital art, logos to product images. Remini can handle it. Available on mobile as well as web.

Tiny Storie

Personalized audio storytelling for children build using AI. The aim of TinyStorie is to help parents in their daily lives by providing them with a tool that allows them to customize the context of something as wonderful as a story, once we saw that the idea could make sense and having tested it with more than a thousand real registered users in just two weeks that have given us feedback, we want to continue helping and for that we are working to present the app to organisations that support children's causes, because this type of causes "are not a story", we want TinyStorie to serve as a tool to raise awareness and funds for such causes, so that when someone buys the subscription or a pack of stories a part of it goes to one of these charitable causes.

Dystr

Dystr helps mechanical & electrical engineers write and run code in the cloud seamlessly without software experience. The product allows users to write and run code in cloud ready environments, nearly eliminating the need for any knowledge of Python or even how to provision cloud environments like Google Cloud, Microsoft Azure or Amazon’s AWS. It includes natural language code manipulation using Generative AI, triggers and scheduled tasks, and remote cloud environments that are provisioned as needed. This enables technical, hardware & manufacturing focused engineers the ability to conduct analysis more quickly and efficiently, and to automate tasks they otherwise couldn’t.

Yuma

Yuma Ticket Assistant is an AI that integrates with your Help Desk software to automate response drafting for customer tickets. Improve efficiency and support quality, increase customer satisfaction, and boost revenue. Currently empowering Shopify merchants using Gorgias.

Faqx

FAQx is an answer engine that is powered by Humans and Enhanced by AI. Powered by Humans. Enhanced by AI. 42 Languages Supported. 339K Facts from 12K Contributors. Connected to: Live Web, Wolfram Alpha, Weather, and More!

Metaphor Systems

Metaphor is a search engine that understands language – in the form of prompts – so you can type what you're looking for in all the expressive and creative ways you can think of.

AI Mailer

AI Mailer uses GPT to produce emails of a high quality. It is a cutting-edge tool that makes it simple and quick for companies and marketers, writers, students and everyone who writes emails to create personalized and professional emails.

Shaped

With Shaped, you can build powerful ranking models that understand the content your users are most likely to engage with or buy. You can use this understanding to create personalized discovery pages, feeds, recommendations and marketing communication that your users will love.

Caroot

Caroot is an AI assistant that helps independent workers maximize their productivity. We’re an all-in-one solution for managing tasks, handling gigs, and streamlining communication. You can just simply make your requests, then wait for Caroot to return your output in no time, without managing the process all along

Shownotes

Convert YouTube automatic captions into podcast Shownotes with the help of chatGPT. Generates a landing page with a summary and a memorable quote from your podcast for you to share. Includes timed captions file and the complete transcript.

Postly

A complete social media marketing platform enabling users to plan, design, and distribute campaigns at a large scale. It has copywriting, digital ads, emails, image and video editors, link shorteners, approval workflow, and one-click publishing features. Additionally, a bulk upload choice is offered. Postly assists businesses and marketers in increasing engagement, conversions, and marketing campaigns.

Vectorizer AI

Convert your JPEG and PNG bitmaps to SVG vectors quickly and easily with Vectorizer.AI! Just pick an image and it's converted for you fully automatically. Works great on blurry and noisy images that typically pose vectorization challenges.

Typeface

Typeface tool allows users to describe their thoughts and Typeface will curate content accordingly. The Blend feature learns the user’s tone, personas, and products to express their vision consistently. The Flow feature offers templates or allows users to create their own with just a few clicks.

Smartscout

AI Listing Architect (Powered by SmartScout) is an AI-powered tool that helps Amazon sellers optimize their product listings for search engine optimization (SEO) by using data and keywords that are already ranking well on Amazon. Additionally, it provides recommendations to make the listing more engaging. The tool generates optimized listings by analyzing this data and incorporating relevant keywords into the listing.

Codium

At CodiumAI, we are redefining and automating Code Integrity, initially by building a dev tool that will enable busy devs to generate meaningful test suites interactively within their IDE. CodiumAI currently supports Python, and JS & TS support is coming soon.

Animeai

AnimeAI generates you as the main hero from top-rated anime! You become characters from Attack On Titans, Naruto, Evangelion, Cyberpunk and Demon Slayer anime from your own photos. Get 120 personalized unique arts!

Evolup

A tool that makes it simple for users to start their own affiliate store. Strong artificial intelligence, Amazon synchronisation, cutting-edge SEO features, hosting and installation of the solution, and more are all made available. Additionally, it has a full dashboard for managing SEO, automatic product import, and availability and price synchronisation. Evolup offers monthly or annual plans, as well as a 7-day free trial with no credit card or commitment necessary.

Wisio

Wisio is an AI-powered platform for scientific writing, providing personalized suggestions for text, translate from any language to scientific english, instantly search and reference the latest findings.

Affable.AI

If you are currently managing Influencer Marketing campaigns manually over excel-files and DMs, Affable's end-to-end influencer marketing platform can help you streamline your entire influencer marketing process.

AIgur.Dev

A free and opensource (MIT) library to compose and invoke fully typed Generative AI pipelines. Create an Image through your voice or a poem through an image! Use Generative AI for use-cases you didn't think of before.

AI Screenwriter

AIScreenwriter is a state-of-the-art tool designed to streamline the screenwriting process, allowing writers to create compelling stories with ease. The tool uses cutting-edge AI technology to analyze your writing and suggest improvements to make your script more engaging and entertaining.

Your Own Story Book

Get ready to embark on fantastical and exciting journeys with your furry friend, courtesy of our awesome website! Unleash the full potential of cutting-edge AI technology and watch in awe as your pet's thrilling escapades are brought to life through fun and vivid illustrations. Best of all, we'll handle the printing and shipping so that you can relive these unforgettable moments in the form of a truly unique and personalized storybook, delivered straight to your doorstep. Get ready for endless fun and adventure!

Edaly

AI Powered EdTech SaaS enabling educators and learners to connect globally with remote education. Edaly brings the credibility and authenticity of online exams and test via live proctoring with smart AI algorithm. It also empower parents to explore their child potential talents and skills and uses AI to predict their optimal career path.

Møbel

Upload a photo of your room, and an AI will generate different variations of the picture, complete with different furniture arrangements, color schemes, and decor options. You can then browse through the variations and find inspiration for your next decorating project.

Contlo.AI

Contlo.ai is a one of its kind AI marketer that provides a conversational UI for controlling all marketing activities via chat. It assists in end-to-end campaign management, offers simple customer segmentation, provides deep insights, enables ad management and social media posting, and facilitates writing of SEO-optimized blogs and marketing copies.

Tripadvisor Summary

This website helps you make a decision about a hotel you are thinking of booking. It does this by providing a summary of reviews from Tripadvisor. All you have to do is copy the URL of the hotel from Tripadvisor and paste it into the website. You can then select the style of summary you want and the website will generate a summary of the reviews of the hotel that is up to 100 words long.

Superflows

Superflows is an AI email assistant that helps you get through your inbox faster with AI generated 1-click replies, customised to your workflows and tone of voice. For each email, Superflows prepares several intelligently generated reply options, ready to go in a single click. You can personalise the options with calendar links and other information, so you never have to copy-and-paste into an email again.

Prompthunt

Prompt Hunt helps people create amazing artworks in just a few clicks! It offers a range of tools and services, including Vector Illustration Technique, Isometric Perspective, Soft Color Palette, and Golden Hour Time of Day. It also has different pricing plans, with the basic plan being free and the Pro plan being $9.99 per month. Create professional images quickly and easily with Prompt Hunt.

Openai Text Classifier

The intended use for the AI Text Classifier is to foster conversation about the distinction between human-written and AI-generated content. The results may help, but should not be the sole piece of evidence, when deciding whether a document was generated with AI. The model is trained on human-written text from a variety of sources, which may not be representative of all kinds of human-written text.

Springworks

Albus is an AI assistant inside Slack. You can ask Albus questions directly by messaging the application. Some examples include marketeers using Albus to create personalized and engaging content for their target audience, or designers could use Albus to generate ideas for new designs and to create unique and engaging visual content.

Sellesta

Helps Amazon sellers optimize their product listings and increase sales. Features include listing optimization, listing scoring, review analysis, and competitive analysis. Also provides a keyword database to make keyword research easier. They have a free plan to try out the main features, a basic plan for $5 a month, and a pro plan for $39 a month. They provide insights, review analysis, and listing optimization tools to help sellers get the most out of their Amazon listings.

Snape

Make job descriptions exciting with personalised and curated copy powered by AI with just two steps. You just need to customize the details and requirements in accordance with the job role and you get a highly personalized job description in seconds.

Researchrabbit

ResearchRabbit learns what you love and improves its recommendations! Keep up with the latest papers related to your collections! If we’re not confident something’s relevant, we don’t email you—no spam! Visualize networks of papers and co-authorships. Use graphs as new “jumping off points” to dive even deeper! Collaborate on collections, or help kickstart someone’s search process! And leave comments as well!

AI Lawyer

Say goodbye to expensive consultations, long waits for appointments, and confusing legal texts. With the AI-lawyer platform, you can get expert legal advice and document creation/summarizing/comparison tools anytime, anywhere. Our user-friendly interface speaks plain language, so you don't have to be a legal expert to understand your rights and obligations.

Berri AI

Berri let's you bring in your data and spin up an app in minutes (you get both an api endpoint to query and a shareable web app) as well as rapidly prototype (we provide templates and offer a 1-click deploy to test this insanely fast). We provide an easy low-code/no-code interface + best-in-class customer support (<1hr response time).

Jibewith

Transform your social media strategy with the power of AI. Connect with your audience on social media like never before with AI-generated posts that #jibe with your brand and target demographics.

Watermark Remover

WatermarkRemover.io is an AI-powered tool that automatically removes translucent watermarks from images in a matter of seconds. We allow people from all over the world to benefit from the strength of our product for both personal and professional purposes.

Glass.Health

Effective problem representations, also known as diagnostic one-liners, include relevant demographics, pertinent history or epidemiological risk factors, duration and tempo of the illness, as well as key signs and symptoms and key data (laboratory, imaging, physical exam data). When possible, signs, symptoms, and data should be consolidated into a description of a clinical syndrome.

Fathom.Fm

Fathom.fm is your AI podcast copilot. Get amazing recommendations, share your favorite clips, search inside podcasts, read transcripts, navigate episodes using chapters, and so much more. It's a whole new way to experience podcasts!

Begone Spammer

Generate personalized snappy replies to uninvited emails. You can paste the unsolicited message and choose a reply flavor to generate a reply, though personal information should be edited out. Begone Spammer does not process or save email content, and users should proceed with caution when using the platform. Donations are accepted to help keep the project alive.

Travelmate

AI generated guides for thousands of cities around the world. Users can discover their perfect holiday destination with the help of AI. Explore our detailed guides for thousands of cities around the world.

Fgeneds

FGenEds provides users with cheat sheets for general education classes. It allows users to upload a PDF of the lecture slides and transforms the material into an easier to digest format.

Formula Generator

Free AI toolkit that helps you quickly generate excel formulas, VBA automation, regex, and SQL queries. You can also get answers to spreadsheet questions without leaving sheets. You can install their Google Sheets Add-On for free and use their Answer Bot to get answers to questions about spreadsheets, formulas, and more. Their intuitive interface allows you to generate formulas quickly.

Ultrabrainstomer

UltraBrainstomer is a cutting-edge brainstorming tool that harnesses the power of artificial intelligence to help you unlock your creativity and elevate your work. Whether you're in need of business ideas, writing a speech, composing social media posts, or crafting emails,

Wisecut

Wisecut is an online automatic video editing software that leverages AI and voice recognition to edit videos for you. Harness the power of AI to create engaging videos at lightning speed!

Waverly

Waverly helps you focus on the content you need without distraction. Our AI understands what you care about and surfaces only relevant content that won't waste your time. Get a customized feed that lets you track industries, trends and markets

Roast

ROAST helps people 10x their matches on dating apps like Tinder, Bumble, and Hinge. It provides people with real feedback, boosts their profile, and helps them find the best pics to use. Also offers data-driven dating insights and expert advice to increase the quantity and quality of their matches.

Paperlist

This website is about sharing and reading research papers. It has a log in and sign up page and also multiple research papers listed on the website. Each paper is accompanied by the name of the author, the time it was posted, a source and a discussion option.

Komo Search

Komo Search leverages generative AI to put your search journeys first, instead of a laundry list of links. [Chat] Deep dive, brainstorm or discuss topics. [Explore] See what the community is talking about. [Search] Get quick answers or links to resources.

Whisper AI

It's an AI-powered hearing aid. With AI, it learns and adjusts to different hearing situations, like a noisy shopping market or family gathering. It provides regular software upgrades from new features to sound processing.

Reflect AI

Mirror the way your mind works by associating notes through backlinks. Reflect builds you a second brain that you can reference anytime. Can now use Artificial Intelligence directly within Reflect to drastically improve your note-taking and writing.

Fobizz

This website provides teachers with many tools to design digital lessons and enable their students to learn safely. They enable the creation of worksheets, multimedia whiteboards, interactive boards, surveys, websites, video and audio recordings, word clouds, links and files.

Voicemaker

Create audio files for commercial use. Offers features such as voice effects, pauses, speed, pitch, and volume settings, as well as industry-leading features and a developer API. Has 1.1 million users in over 120 countries and has converted over 100 million characters into voiceovers so far.

Awemyface

AweMyFace is a skincare app and AI-powered guide to perfect skin. Take a photo of your face and our artificial intelligence will find acne and show the percentage of the affected area of each zone: forehead, temples, T-zone, nose, cheeks and chin. Any micro change that is difficult to notice even with the closest eye will not pass by the attention of our skincare AI. You will always have an objective picture of the changes. Their AI detects acne with 99.1% accuracy.

Addy AI

Addy is an A.I. email assistant that drafts your emails in seconds, with your preferred style and tone. Addy AI lets you choose from a variety of tones. Customize your emails to suit your needs. Whether you need a formal tone for business correspondence or a friendly tone for personal emails. Addy AI can also learn from your writing style and respond according to the conversation’s context.

Outline Ninja

An automated infographic maker using A.I. Converts a keyword into an Infographic. It requires a keyword and title to generate the rest of the information. It is a part of Outline Ninja's suite of products.

Voxwave AI

Convert ice-cold leads into blazing-hot buyers. Use dynamic tags like {name} and {company} to send hundreds of personalized voice emails to pre-warmed leads. Or send a static voice message to 100k+ cold leads. At whatever stage your lead is at Voxwave gets you more calls booked and more sales.

Clippah

With Clippah, you can: • Easily convert YouTube videos to vertical TikToks • Convert longform videos to shortform candidates with one click • Automatically timestamp your YouTube videos • More features coming soon

Intelli Gift

Intelli.gift is an AI-powered gift advisor that uses advanced algorithms to suggest the perfect gift for any occasion. It takes into account the recipient's preferences, interests, and personality to recommend the best options, saving time, money, and energy for the gift-giver.

Wave AI

Wave Grow is a coaching website that provides infinite coaching and growth opportunities to professionals, executives, and managers. It is powered by an automated coaching intelligence and provides personalized coaching experiences. It has been used by over 500 professionals and provides 24/7 listening and support. Additionally, it provides flexible prices and a safe space that protects confidentiality.

Hot Reach AI

Convert more strangers to customers. Sending personalized intros is great, but stop wasting time writing them! Hot Reach AI increases your reply conversion from cold emails at scale by personalizing introductions using Artificial Intelligence and LinkedIn data.

Wand AI

Wand enables everyone, regardless of their technical skills, to solve complex business problems and create AI-driven business impact quickly and intuitively. Wand delivers the simplest approach to designing, building, and managing AI-based business solutions, streamlining the full AI solutions’ lifecycle, thus reducing time-to-value, spending, and the needed workforce. Using Wand, organizations can extend their AI powers from the technical departments to the business units and bring advanced data science capabilities to the business teams.

Hirelakeai

Screen job candidates and find the best talent for the organization in no time! Extract information from resumes in bulk and match it with the job description to filter out candidates. Speed up your recruitment processes with AI. Increased hiring efficiency and brand recognition with an AI-backed platform. Accelerate your recruitment process with precision like never before!

Nolej

With @nolej_app, upload anything you are trying to learn - YouTube video, web URL, document, etc. It creates various ways to learn: summaries, flashcards, and quizzes. Now learners pick the method they want rather than the method given to them.

Job Description Generator

Effortlessly create job descriptions to attract applicants & referrals with Recrooit’s job description AI generator. After working with 200+ companies, we figured many are struggling with job descriptions, so we built a free, AI-powered tool to do it for you.

Freshly.AI

Provides a free AI (GPT-3 powered) value accruement report for any company. It specifically evaluates a Company's AI value accruement (accumulation) potential based on 4 key criteria: (1) Integrated AI (2) Infrastructure as a service (3) Intelligence layer (4) Invisible AI. In this way, it provides an ‘Ai competence’ company report and value proposition.

Samurai

SamurAI is a community chatbot powered by ChatGPT that can help you start, run, and grow your Discord community. It can set up servers, channels, manage invites, greet users, and respond to questions.

Clio

A Stable Diffusion Prompt Generator, which helps people create stories, art, and music by providing them with prompts. Through this website, users can access a Prompt Helper, S.W.A.G. (which stands for Story Writing Assistance Generator), and a Studio to create their own stories. The website also includes recommended keywords and sources of inspiration from hundreds of independent artists, researchers, and hobbyists.

Kayyo

AI trainer will analyze your movements and provide personalized feedback and recommendations to help you take your training to the next level. Personalized training plans and exercises tailored to your goals and abilities. Detailed video demonstrations and instructions for each exercise. Progress tracking to help you monitor your improvement. Virtual sparring partner to practice your skills in a simulated fight

Upcat

UpCat is a browser extension that can help Upwork users write A.I-generated cover letters for job applications. Use it to enhance your job search on Upwork with personalized proposals and real-time alerts.

Beautiful.AI

A convenient way to create stunning presentations quickly and easily. Has a variety of templates, designs, and features to help you create professional presentations. Offers integrations with Slack, Dropbox, and PowerPoint.

Copyleaks

AI-powered text analysis to identify potential plagiarism and paraphrasing across nearly every language, uncover AI-generated content, verify authenticity and ownership, and empower error-free writing.

Finding Words

AI obituary maker by Empathy. Creating a meaningful tribute to your loved one can be a difficult and emotional task. With Empathy’s Finding Words, you can simply answer a series of questions and our AI will draft an obituary in their honor.

Capturelab

At CAPTURELAB, we auto-fetch your Twitch content as soon as you've signed up. When you're done streaming, our AI will process your content using Computer Vision, detect your best gaming moments, and present them to you for editing. Use the platform to edit, download your video files, and post them on social media to grow your audience.

Authorai

At AuthorAI we are reimagining the authoring experience powered by AI. We are exploring how state of the art in AI can enhance the creative authoring flow as it applies to creating apps, books, blogs, sites, data, designs, reports, etc.

GPT For Me

GPTForMe gives you the power of AI to interact with personal or niche content that the public GPT-3 model doesn’t know about. It’s a prototype intended to demonstrate the potential of GPT-3 for personalized use cases.

Harpa.AI

HARPA AI is a Chrome Extension and AI-powered NoCode RPA platform that saves time and money by automating tasks on the web for you. It provides AI answers to search queries, summarizes web pages, extracts structural data, tracks product prices and stock availability, monitors articles and legislations, detects changes in competitor sites and more. HARPA AI uses a hybrid AI engine built on top of ChatGPT and its own Machine Learning to perform these web automation tasks.

Translatevideo

Translate.video helps in video translation, captioning, subtitle translation, dubbing, AI voice-over, recording, and transcript generation using AI to 75+ languages with just 1-click. Compared to any manual process, this is 100x faster.

Revive

A platform where you can generate business ideas with AI, share them with the world and validate before you build. Just type in your idea, let the AI visualise it for you, share it with the community and get your business plan all under a minute!

Arcwise AI

IntroducingArcwiseAI-theultimateAIcopilotforallyourspreadsheetneeds!PoweredbyChatGPT,thisappmakesiteasytonavigatethrougheventhemostcomplexspreadsheetswithjustafewsimplekeystrokes.WithArcwiseAI,allyouneedtodoispressCmd+Shift+1/Ctrl+Shift+1togetstarted.Fromthere,youcan[…]

Transvribe

Transvribe is designed to make learning on YouTube 10x more productive. It uses AI embeddings to enable users to search any video, and also allows users to paste a YouTube URL to ask their first question.

Ttslabs

TTSLabs gives twitch streamers the ability to customize their Text to Speech donations, enable custom voices, add unique sound clips and more! All with the power of AI TTS and seamless integration with Twitch, Streamlabs and Streamelements.

Prompbase

A free prompt generator that helps people create visuals and stories by providing them with ideas and prompts. It offers a variety of options that can be used to create different kinds of visuals and stories. It has options such as cartoon styles, high quality photo styles, types of shots, and settings. It also provides guidance to help users create the best prompts.

Polymath

Polymath uses machine learning to convert any music library (e.g from Hard-Drive or YouTube) into a music production sample-library. The tool automatically separates songs into stems (beats, bass, etc.), quantizes them to the same tempo and beat-grid (e.g. 120bpm) and analyzes musical structure (e.g. verse, chorus, etc.), key (e.g C4, E3, etc.) and other infos (timbre, loudness, etc.). The result is a searchable sample library that streamlines the workflow for music producers, DJs, and ML audio developers.

Consumerai

The functionality is super simple - based on your problem statement the app finds products which solve/alleviate your problem. Instead of sifting through the web to find remedies for your issues (e.g., trouble falling asleep), you get a solution handed to you on a silver platter. Type in a prompt, click on the results and purchase away!

Textgpt

With TextGPT you can easily access OpenAI’s GPT and Dall-E 2 through text messaging, receiving quick and accurate answers to any question you may have and generating realistic images with a simple text. After signing up, you can text your questions/prompts to a specific number

Retune

The ultimate tool for creating and monetizing fine-tuned language models using GPT-3. With re:tune, you can easily train and customize your own AI assistant for any industry or use case, and generate an API to integrate it into your own applications.

Keywrds.AI

Keywrds.ai is a keyword research and content ideation tool utilizing GPT. Built to be able to find niche relevant keywords, as well a generate questions, topics and blog post outlines. With Keywrds.ai you can scrape the Google 'People Also Ask' questions and automatically generate answers for them.

Arvin

Meet Arvin, the all-in-one AI resume and cover letter writer, AI writing tool for crafting captivating marketing emails, engaging blog articles, effective product listings, and professional job application materials. Explain with as many details as possible to the AI what you would like to write about. Our highly trained AI understands the information you give and generates human like content in seconds.

Sheldon AI

Sheldon is an AI powered virtual assistant for all your tasks on the internet. It can write emails, write code, debug, show excel formulas etc. Over 200+ professionals and creatives use Sheldon. Users get access to all of the features for free with no daily data limits.

Optimo

Optimo, produced by FATJOE, is a free AI-powered marketing program that simplifies and accelerates the marketing process. It comes with a multitude of tools, including Instagram captions, ads, copywriting, SEO, video and email, to help marketers quickly and easily complete their duties. It also offers popular services like blog post titles, keyword clusters, blog post briefs, Facebook ads and Google ad headlines.

GPTionary

GPTionary is a next-generation thesaurus powered by cutting-edge language models such as GPT and other advanced NLP technologies. Developed by college students, it empowers underprivileged communities, particularly non-native English speakers, to enhance their language abilities and open up doors to better education and job prospects. User-friendly, efficient, and easily accessible, GPTionary is the perfect tool to break down language barriers and level the playing field.

Caricaturer.Io

Caricaturer.io is a fantastic web app for anyone who wants to convert their regular images into caricatures. This tool uses AI techniques to transform images. It offers various features to enhance the image’s visual effects, such as adjusting the facial features, adding background colours, and increasing or decreasing the exaggeration level of the caricature. Once you upload a photo, the software will analyse and process the image within three minutes. You can get over 60 caricature photos based on the portraits you provide. The caricature works generated by this app can be free for personal or commercial purposes. If you want to stand out on social media, create a unique gift, or add a touch of humour to your branding, Caricaturer.io is the platform for you. Give it a try and see the fun and unique results for yourself!

Apple Books

Audiobooks narrated by a text-to-speech AI are now available via Apple’s Books. Initially only available for romance and fiction books, where they list two available digital voices: Madison and Jackson.

Appicons AI

AI-generated mobile app icons for both Android and iOS platforms. No image editing software or technical skills are required. Can generate 6 different designs and can select one to crop and preview. You can then upscale and download it.

Prepai

PrepAI is a powerful AI-based question generator that can generate customized question papers, quizzes, assessments, trivia, and more. With PrepAI, you can easily create a range of question formats, including multiple-choice questions, fill-in-the-blank questions, true or false questions, and descriptive questions. Using PrepAI is easy and convenient. Simply upload your content using one of four methods: topic search, text input, PDF or Docx upload, or video file or URL upload. PrepAI can even generate high-order thinking skill (HOTS) questions for you, making it an excellent resource for creating engaging and challenging assessments. With PrepAI, you can save time and effort while creating high-quality assessments and quizzes that are tailored to your needs. Whether you're an educator, a content creator, or a business owner, PrepAI can help you to create effective, engaging, and informative assessments and quizzes.

Taplio

Create more, better LinkedIn content with AI - stop wasting endless hours writing your next LinkedIn post. Get fresh ideas right off the bat using Taplio and our advanced content inspiration layer. AI inspiration, viral post library, latest news. All you need to create a month’s worth of content in an hour.

Voice AI

Free real-time AI voice changer. Other features include voice cloning and custom voice integration in your app. It can be used by streamers, gamers, and businesses for meetings and calls. 50k monthly active users in the first month of beta, the world's first de-centralized UGC platform for voices.

Web3 Summary

Use ChatGPT and AI to break down complex crypto projects into simple explanations. It provides breakdowns of tokenomics, economic models, and performance metrics and can analyse any NFT, DeFi, Swap, or even Blockchain in a matter of seconds.

This Resume Does Not Exist

Stand out among the competition with over 1000 AI-inspired resume examples. See what works for the resumes of the world’s most successful people, and create a resume that’s just as good.

Doctrina AI

Built on top of the powerful GPT-3 language model from OpenAI, this product is designed to help students and children study better and adapt to the new challenges of remote and online learning.

Promptable

Streamline your GPT-3 prompt engineering workflow with Promptable's advanced tools and features. You can also organize your prompts, track changes, evaluate and deploy your prompts. There is also a community associated with it.

Midjourney Splitter

Use the MJSplitter to split your Midjourney Grid into single images. You can input the image either by uploading or pasting a link. After splitting, you can download the images and save them to your computer in JPEG. You can also share your images on social networks.

Roamaround

Roamaround is an AI itinerary maker, simply enter your destination city, Date of arrival and days of stay and the tool will make your entire itinerary for you. You can also subscribe to get exclusive deals and more.

Iris.AI

A comprehensive platform for all your research processing. Smart search and a wide range of smart filters, reading list analysis, auto-generated summaries, autonomous extraction and systematizing of data.

Coach Marlee

Coach Marlee by Fingerprint For Success is an AI coach that uses science-based coaching methods. Everyone with internet access can now afford life-changing coaching that the world's top performers, CEOs, celebrities and leaders have used as the secret fuel for their success for decades.

Eightify

IntroducingEightify,theinnovativewebappthatallowsyoutoturnanylongYouTubevideointoaconcisesummarywithjust8keyideas.WithEightify,you'llbeabletoquicklyandeasilydetermineifavideoisworthwatchinginjustamatterofseconds.Thispowerfultoolisperfectforanyonelookingto[…]

Mechanic For A Chat

The online troubleshooting mechanic chatbot provides fast, convenient, and expert assistance for car problems 24/7, offering a user-friendly solution for managing vehicle maintenance and health.

One AI

Deploy the world's best Language AI in your product within days. Select from our library, fine-tune, or build your own capabilities to analyze and process text, audio and video at scale.

Promptstacks

They offer a suite of free vetted prompts curated for large language models such as ChatGPT and delivered through prompt engineering so that you can spend your time on important things. There's also a community associated with it where you can see the top voted prompts, submit prompts or join their discord.

Quicklines

Quicklines automatically creates personalized ice breakers to inject inside cold emails. Upload a CSV, wait 3 minutes, and receive the sheet with lines written. Put those lines into the first sentence of cold emails, and watch your responses increase 3x-7x.

Gooey.AI

A low-code platform to discover, tweak and compose AI workflows. Offers a unified billing layer to enable API access to the latest Generative AI models (e.g. OpenAI’s GPT3 + DallE, Lots of Stable Diffusion image models, Voice generators, LipSync, InstructPix2Pix, etc) plus more paid APIs such as social profile lookups and SEO APIs. Tweak a workflow and then immediately use it as an API in your own app. Prototype how AI will integrate with your own site/app.

Promptly

Promptly provides predefined prompts for AI writing software such as ChatGPT, Jasper or others. Promptly is a tool that enhances the capabilities of AI writing software such as ChatGPT, Jasper, or others. It offers a collection of pre-written prompts that users can use as a starting point for their writing projects, helping to streamline the creative process and make it easier to generate high-quality content. With this item, users can quickly access a variety of writing prompts, from simple questions to more complex scenarios, and start generating content in just a few clicks. Whether you're a writer, marketer, or content creator, this item can help you produce engaging, compelling content more efficiently, making it a must-have for anyone looking to get the most out of their AI writing software.

Liveai Bot

Have access to a powerful chatbot that works 24/7 to keep your community engaged and active. Whether you need help generating images, composing tweets, writing code, or even creating articles, LiveAl Bot has got you covered.

Circleback.AI

Circleback transcribes your meetings and crafts notes and follow-up emails that’ll blow you away. Our natural language search lets you ask questions about past meetings like “what is Chris’s biggest problem with their current sales process?”, the same way you’d ask ChatGPT. Circleback works with Zoom, Google Meet, Microsoft Teams, WebEx, and BlueJeans amongst others. Start for free today.

Article Fiesta

An AI writer to help you create articles for your website or blog. All you need to provide is your keyword, and we will take care of the rest. Our AI robot will create long-form, SEO-ready articles ready to be published on your site today. Don't bother with other sites which just write content. Article Fiesta adds rich, royalty-free images, SEO in article ranking features, and can even auto-build internal links from within the article to your website content. Try us free. No credit card needed.

Lessonplans.AI

LessonPlans is an AI-powered lesson plan generator developed by teachers to help teachers create high-quality lesson plans in a fraction of the time. The AI-generated lesson plans include a step-by-step guide for each lesson, making it easy for teachers to follow and implement the plan in their classrooms. It also allows teachers to customize the lesson plans to fit their teaching style and students’ needs.

Clips AI

Clips AI automatically creates social media clips from long-form videos like podcasts, webinars, and vlogs. This allows content marketing teams to save time and easily increases metrics on socials.

Pickaxe

Pickaxe allows anyone to create tools powered by AI, in minutes, no code required. You can discover AI tools made by the pickaxe community, make your own AI tool and share it and collaborate with the community.

Examcram

With ExamCram, students can convert any type of media, such as lectures or textbook passages, into personalized study materials, including flashcards and practice tests. The app's AI algorithms automatically identify key concepts and create questions based on them, making it easy for students to focus on the most important information.

Kickresume

Kickresume is an all-in-one career toolbox that helps you create a beautiful resume or cover letter in seconds with the help of AI and customizable templates. It’s powered by OpenAI’s GPT-3, the world’s most powerful language model, and it can automatically produce text indistinguishable from human writers. Say goodbye to writer’s block. Generate the first draft of your resume or cover letter in seconds.

Lexii.AI

Lexii.ai is an AI search assistant that answers questions and cites sources. It is powered by GPT-3, a cutting-edge natural language processing technology. Lexii can provide you with accurate, up-to-date information on any topic.

Promptvibes

A Massive Collection of Useful ChatGPT Prompts, that will turn you into a ChatGPT Expert. It explains what the prompt does before showing the prompt, so you don't waste time trying different prompts

AI Reality

AI Reality is a platform that enables you to generate simple augmented reality prototypes using text from AI. We use the power of Stable Diffusion and Open AI to generate an AR experience in a few seconds. Their mission is to massify the use and learning of Augmented Reality through a friendly process thanks to AI.

Makemytale

An innovative platform that allows users to create their own unique stories using AI technology. MakeMyTale provides an easy and exciting way to bring stories to life. Users simply choose a theme and characters, and the AI generates a customized tale that can be personalized even further through co-authoring.

Corpora

Dont just organize your documents. Understand it. We uses AI language models to help you automate research workflows, like parts of document review. We can search for relevant documents without perfect keyword match, summarize takeaways from the document specific to your question, and extract key information from the document. We can help with brainstorming and summarization.

Whisper Memos

Whisper Memos is an app that records your voice and sends you an email with the transcription a few minutes later. Use it to record quick thoughts, reminders and daily journal entries.

Maverick

Build strong relationships with your customers by utilizing automated personalized videos. We at Maverick assist different businesses like e-commerce brands, online retailers, healthcare, and more with AI and Deep Tech to generate thousands of unique personalized videos. You need to record yourself once, and Maverick will produce thousands of unique customized videos in which you address each consumer by name. So what are you waiting for? Send automated personalized videos to your customers and increase your conversions.

Bright Eye

Bright Eye is a multipurpose AI app that has multiple tools to satisfy your your interests in AI as a mobile user. Among its tools are art/image generation, code generation, essay and poem generation, and text extraction and image captioning.

Better Synonyms

A convenient way to find better synonyms for words in a specific context. It enables you to search for synonyms that will fit more naturally in a sentence, making it easier to convey their desired meaning.

Ttsmaker

TTSMaker is a completely free online text-to-speech tool that supports unlimited usage, including commercial use. With over 200 AI voices and support for multiple languages including English, French, German, Spanish, Arabic, Chinese, Japanese, Korean, Vietnamese, and more, you can choose from a variety of voice styles to read your text and e-books aloud. You can also download the synthesized audio files. No registration or payment is required, you can use it directly online for free forever.

Venngage

Enter your valentine's name, their relationship with you, their likes and the type of card you want to generate and let the product do the work! Make sure to select all fields or else it won't work. You can also generate random cards using it.

Skim It

Get an ai summary of any article delivered to your inbox. You just need to email them at [email protected] and they email back a summary within ~10 minutes. They also send you drafts of shareable tweets and a LinkedIn post.

Noty.AI

AI meeting assistant transforming Google Meet into actions, tasks and follow-ups. Features include: Real-time transcription and one-click highlighting. AI summaries and meeting intelligence. Automated Follow-up.

Visualhound

Prototype your fashion design ideas with AI. Create an infinity of realistic-looking product images to feed your moodboards and boost your design process. Easily visualize your product designs before going to production.

Wisdolia

A Chrome Extension that uses AI to generate flashcards (with questions and answers) for any article / PDF so that you can better ingrain what you read. Flashcards can be saved to Anki, which has a built in spaced repetition system. Upgrade your learning and studying habits and become a super learner ⚡️

Repl AI

Chrome extension to create meaningful Twitter replies with AI. Replai.so is the easiest way to connect with the community, look clever, funny, professional on social media, appear smarter and grow your audience with 10x less effort. You can find it on the chrome webstore.

Writegpt

WriteGPT is empowering professionals to become Superhuman with everyday tasks. Overcome unproductive browsing habits by accessing writeGPT using only a seamless keyboard's hotkey. Further, we facilitate prompt engineering to effectively read, write, rewrite, reply to emails, code & research any content.

Chatgenius

Experience the future of conversation with Chat Genius - the GPT-based AI chatbot app that provides smart and seamless conversations to create your own virtual assistant, personalized to your liking. Choose a name and gender, and let your assistant help you with various tasks, answer your questions and even converse with you.

Neevaai

NeevaAI provides authentic, real-time AI search. It combines the power of AI with a search stack to give you fast, accurate, and up-to-date results. And, it provides sources where the information was pulled from.

Tradeui

TradeUI provides an array of powerful A.I data-driven tools to help traders find better trades, improve win rate and profit, including options flow, technical analysis, trading signals and more. TradeUI also provides real-time alerts as notable events take place on the markets.

Corrector App

Check your text with this online spell checker. Any mistakes you have made or grammar suggestions for altering the writing to flow better will be highlighted. Just click on any of the corrections to transform them into something different. They will also explain the grammar mistakes so that you understand where you have gone wrong.

Present AI

Create amazing presentations quickly with AI. Offers a variety of visuals to choose from, including Low Poly, Cyberpunk, Surrealism, Anime, Realism, Memphis Design, Fantasy, and Cartoon. Also allows users to enter their own text to create presentations.

Welma

Welma uses AI to simplify complex sentences and paragraphs, making them easy to understand. Whether you're reading an academic paper, a news article, or even a novel, Welma will help you make sense of the text and retain the information.

Photor AI

Photor AI is a tool that uses advanced image recognition and machine learning technology to analyze and select the best images for professional or personal use on platforms like Linkedin, social media and dating apps. It helps you present the best version of yourself.

Moji Writing Assistant

Powered by GPT-3, Moji helps you write better content faster and with less effort. One of the standout features of our app is the text-to-image feature. This tool allows you to turn your written words into visually stunning images, perfect for social media or to add a little extra oomph to your blog post. Along with this, you are also able to make your own music using this app.

Hacker AI

An AI that hacks you to secure your applications. Use for cybersecurity professionals and anyone else who writes code. Hacker AI detects vulnerabilities in source code. Free with a freemium API releasing soon. Made by https://twitter.com/chaignc

Studio Design

Studio's first release is an AI-augmented design app for creating modern websites. It comes with a powerful experience unlike any other: Highlight an area you are stuck on. Marvel as design suggestions appear before your eyes. Speak to it. Watch as multi-step tasks autocomplete themselves. Press one button. Observe as your design adapts to fit all screen sizes.

Techcrunch Summary

News summarizer with GPT-3 – specifically for TechCrunch articles. This project uses the OpenAI GPT-3 API (specifically, text-davinci-003) and Vercel Edge functions with streaming. It fetches the content on a Techcrunch article, sends it in a prompt to the GPT-3 API to summarize it via a Vercel Edge function, then streams the response back to the application.

Promptist

Promptist is a prompt interface for Stable Diffusion v1-4 that optimizes user input into model-preferred prompts. The online demo at Hugging Face Spaces is using CPU, so slow generation speed would be expected. Please load the model locally with GPUs for faster generation.

Neurospell

NeuroSpell is a spelling and grammar auto-corrector based on Deep Learning. Available in more than 30 languages. Dictaphone (Speech-to-Text) included for all languages. May be trained for specific in-domain vocabulary and phrasing, and specific error corrections. Other features include - Human-in-the-loop charge optimization. Text-stream improvement/enrichment. Writing Aid. Proofreading RPA. Customer-workflow inputs enrichment. Speech-to-Text enhancement. OCR error correction.

Pixelhunter

Cropping each and every image by hand can be tiresome. Pixelhunter utilizes amazing Uploadcare Intelligence API to recognize objects and crop pictures automatically, in a smarter way.

Superhuman

AI powered email inbox. Claims to automatically sort important email based on behavioral patterns, allows you to set reminders and holds you to them. Adds open rate tracker + undo send feature.

Cowriter

Cowriter is an AI writing tool that can help you speed up and inspire your writing by generating content for you. All you need to do is ask, and Cowriter will take care of the rest. With Cowriter's editor, you can generate creative blog posts, essays, headlines, images, or any other content in minutes, all optimized, especially for marketing and creative use. In addition, Cowriter can help you improve your content by rewriting it to be more engaging, shortening it to be more simplified, etc.

Safurai

Safurai is an AI-based IDE extension designed to assist developers with coding, debugging, and refactoring. It acts as a virtual assistant, providing solutions and suggestions for any issues that may arise during the software development process. With Safurai, developers can improve their workflow and code quality, making the development process more efficient and streamlined.

Mixo.Io

Mixo helps entrepreneurs quickly launch and validate their business ideas. It has an AI-powered builder that can generate a website in any language in seconds from just a brief description of an idea. Mixo also helps to collect customer feedback and grow audiences with integrated subscriber management tools.

Youtube Summarized

This Chrome extension enables you to summarize YouTube videos of any length using your OpenAI key. It is very useful for creating notes or finding the main points of a video without having to watch it.

Paperade

Paperade is the first AI-powered tool that generates commercial use cases and company ideas from over 100 million academic papers and research studies. It's like having a PhD in startup ideas.

Grammarly

Write confidently with Grammarly's new AI-powered application. Go beyond grammer and spelling to style and tone with auto suggestions. Works with emails, documents, social media and almost everything.

Ebsynth

EbSynth is a free software app that allows you to animate existing footage using just a few styled keyframes. It is perfect for hand-drawn animations that typically would take a long time to animate.

AI Cli

Open Source GPT -3 Powered CLI The current prompt length is ~840 tokens and the pricing for text-davinci-002 is $0.02 for 1K tokens which is ~$0.017/command. We'll see if we can improve the response as well as reduce the per-command-cost with fine-tuning.

Reface

An AI app to face-swap in GIFs and videos. Their AI Avatar feature allows the creation of high-quality artwork-like portraits (available on iOS & Android). Upload 10 photos, and wait for an hour. Get 48 unique artworks with yourself as the main character in various art styles — from superheroes to cyberpunk.

Morise.AI

Trained with data from the most successful content on YouTube, Morise.ai helps you get ahead on YouTube with the power of AI, while just focusing on creating videos and not worrying about the algorithm anymore. It can help you generate your next video idea automatically to potentially plan out months worth of content. Along with that, Morise.ai also features: - Video Titles Generator - Video Tags Generator - Video Description Generator - Community Posts Generator In general, it is an all-in-one AI powered toolbox for YouTube creators.

Gita GPT

GitaGPT is a website that uses Artificial Intelligence (AI) to help people get guidance from the Bhagavad Gita, an ancient Indian scripture. It provides more than 71,108+ updesh (spiritual instruction) that can help people of all ages and backgrounds.

Oss Insight

Data Explorer by OSS Insight is a GPT-powered querying tool for GitHub live data exploration. Simply ask your question in natural language, and Data Explore will generate SQL, query the data, and present the results visually.

Creator AI

Creaitor is an AI-powered content writing platform that provides users with a smart and efficient solution to writing copy. The platform leverages cutting-edge AI technology to generate high-quality content in multiple languages, freeing up users' time to focus on the things they do best. With Creaitor, you can produce articles, social media posts, product descriptions, and other types of written content quickly and easily, without having to spend time and energy on writing copy.

Rtutor

RTutor is an AI-based app that can quickly generate and test R code. Powered by API calls to OpenAI's Davinci (ChatGPT's sibling), RTutor translates natural languages into R scripts, which are then executed within the Shiny platform. An R Markdown source file and HTML report can be generated. Check out the github repo here: https://github.com/gexijin/RTutor

Alfred

Alfred is a GPT Chat Assistant for iOS. It is a new AI-powered search and content creation engine, combining ads-free search and content creation into one easy-to-use app experience. Powered by OpenAI's groundbreaking GPT-3, Alfred understands your natural language and provides accurate and relevant answers. With Alfred, searching and finding information has never been easier or more convenient. Try it now and experience the future of search and content creation.

Find Your Next Book

Find Your Next Book is a book recommendation service for people struggling to decide what to read. Simply describe your desired read in terms of character, setting and/or plot and we'll recommend the best option from our database of thousands of books.

Lookup

Get answers from your data in seconds. Lookup is the AI-powered analytics platform that helps you get from data to insight 10X faster. Import your data, ask questions, get results instantly.

Analogenie

analogenie is a simple and intuitive tool to generate analogies, improve your arguments, explain complex concepts, and help readers get a better understanding of your content. Along with analogies, users also get relevant gifs. They can download the gifs or directly copy the embed link to add on content

Pixelicious

An online image-to-pixel art converter. It allows people to upload their images and convert them into pixel art that can be used for game development. After uploading the image, it will be processed and the user can download the result.

Bedtimestory

Create personalized, instant bedtime stories in seconds. Generate a story about your child, including some family members as characters, and add a genre, story style, moral, and much more – generated using artificial intelligence. Their open library has 5000+ stories. Explore all the stories created by the community. You can like stories, bookmark them into your collections, re-mix* them, share with friends, read to your kids.

Slidesai

Create Presentation Slides with AI in seconds Say goodbye to tedious, manual slides creation. Let the AI write the outline and presentation content for you. With their tool, you can easily create professional, engaging slides from any text in no time. Works with Google Slides. Coming soon for Microsoft Powerpoint.

Murf.AI

Go from text to speech with a versatile AI voice generator AI-enabled, real people's voices Make studio-quality voiceovers in minutes. Use Murf’s lifelike AI voices for podcasts, videos, and all your professional presentations

Ingestai

A tool that helps people turn their knowledge base into a chatbot-like assistant. The tool is compatible with Slack, Discord, Whatsapp, Telegram, and more. It takes minutes to get started and supports uploading Knowledge-base files such as Markdown, TXT, Word, Excel, PowerPoint, Notion and Confluence. It will provide accurate AI/Chatbot-generated answers to questions about related materials. People can use it to help answer questions about their product, services, company knowledge base, and more.

Vidiq

VidIQ is a SaaS product designed to help YouTube creators find topics and keywords for their videos. VidIQ's AI features include personalized prompts for your next video, view prediction count, and predictive analytics.

Sheetgod

Create complex Excel formulas using plain English with SheetGod. Our AI-powered tool also allows you to create macros, regular expressions, and basic tasks, as well as Google Appscript code snippets to automate your daily manual work. Try it now and experience the power of SheetGod.

GPT3 Playground

Enter an instruction or select a preset, and watch the API respond with a completion that attempts to match the context or pattern you provided. You can control which model completes your request by changing the model.

Casper AI

A tool for professionals to simplify their workflow by summarizing articles, creating content and sharing insights with stakeholders Unlock the power of AI with Casper's Chrome Extension. Casper streamlines your workflow with insights and summaries, utilizing OpenAI's GPT. Whether you're preparing for an exam, conducting due diligence on an investment, working on a major deal, or trying to stay on top of new legislation, Casper will make your job easier.

Instanovel AI

InstaNovel.ai uses GPT-3 and Dall-E 2 to generate the contents of the book. All you need to do is enter a prompt and choose a visual style a whole mini-novel will be generated for you. It's free to use with a limit of 1 book per person. Currently, it is only available in English, however, more languages will be added in the future.

Reimagine Home

It is one-click interior design generation tool. Whether you're looking to refresh your living room, revamp your backyard, or create a whole new look for your home, REimagine Home has got you covered. With no design knowledge required, you can easily try different design, color, and style combinations to create a unique and personalized space.

Robin

Automated cold email outreach, written by GPT. With Robin AI, you can easily and effectively reach out to leads, conduct research, and handle initial outreach - all without the need for a human sales associate.

WhereToAI

Helps you pick a destination for a trip somewhere in the world based on your preferences. It will also generate an itinerary along with some useful information and the destination. You can also generate a trip for the USA or Ireland specially if you prefer.

Soofy

Soofy is an AI language-learning app that offers an innovative approach to mastering a new language. With a focus on practice and real-life scenarios, Soofy provides users with features to improve pronunciation, writing, and conversation skills. From writing essays and describing images to making debates and role-playing scenarios with an AI, Soofy offers a wide range of language options and engaging features to help you practice and improve your language skills.

All Search AI

Search across the contents of 1000s of books. You can adjust the time span from where you want the results to be shown, the genres, the number of results you get as well as the speed and the quality.

Echowin

Automate Incoming Calls With AI. Get a new phone number or bring your existing one. Your customers will call our AI-powered system that will help them get the answers they need, perform business tasks or connect them to the right person if needed. You can focus on running your business while we handle the calls!

AI Experiments

AI Experiments is a showcase by Google for simple experiments that make it easier for anyone to start exploring machine learning, through pictures, drawings, language, music, and more. You can find tools like TalkToBooks and TeachableMachine here.

Xpression Camera 2.0

Xpression Camera is an award-winning virtual camera app that allows users to instantly transform into anyone or anything with a face with a single photo without any processing time. xpression camera enables users to redefine their onscreen persona in real-time while chatting on apps like Zoom, live streaming on Twitch, or creating a YouTube video.

Papercup

Papercup translates videos with expressive AI voices, allowing any video to be watched in any language. With AI dubbing, localization is faster and more affordable, allowing content owners and creators to reach large audiences in days without stretching budgets. Use AI to dub your content into multiple different languages, just like our clients Bloomberg, Insider, Jamie Oliver, BBC and Sky News.

Amazon Codewhisperer

Amazon CodeWhisperer is a machine learning (ML)–powered service that helps improve developer productivity by generating code recommendations based on their comments in natural language and code in the integrated development environment (IDE).

Easy-Peasy.AI

Easy-Peasy.AIisanAIcontentassistantthathelpsyoutellyourstoryinthemostengagingwaypossible.OuraffordableAIwriterisdesignedtomakeiteasyforanyonetocreatecompellingcontentquicklyandefficiently.Easy-Peasy.AIistheperfecttoolforanyonelookingtocreatecontentfortheirwebsite,blog,orsocialmedia.[…]

Releasenote.AI

Release Notes Simplified with GPT-3. Just list down your features & updates, and let the AI write your first draft. It even lets you write your release notes in the speech style of Yoda, Sherlock holmes, Eminem and more

Maps GPT

Helps users quickly find and explore interesting places near them using AI. Type in what you're looking for, where you're looking for it, and your email. The app will send you a custom map with what you're looking for. The map is curated from aggregated data.

Laion

LAION, as a non-profit organization, provides datasets, tools and models to liberate machine learning research. They encourage open public education and a more environment-friendly use of resources by reusing existing datasets and models.

Microsoft Bing

Microsoft's Bing now integrates AI in it along with a browser co-pilot. The new Bing is like having a research assistant, personal planner, and creative partner at your side whenever you search the web. With this set of AI-powered features, you can: Ask your actual question. When you ask complex questions, Bing gives you detailed replies. Get an actual answer. Bing looks at search results across the web to offer you a summarized answer. Be creative. When you need inspiration, Bing can help you write poems, stories, or even share ideas for a project. In the chat experience, you can also chat and ask follow-up questions such as, “can you explain that in simpler terms,” or, “give me more options” to get different and even more detailed answers in your search.

SwagAI byt Slingshot

SwagAI is an AI tool that helps you come up with ridiculous company swag. Just tell us what you’re looking for, and our algorithms will recommend crazy (but sometimes practical) options.

Latent Labs

Generate a 3D world that you can look around in based on your text prompt. Has support for different versions of Stable Diffusion and has a Discord Community that you can join as well.

Copymatic

Generate Content & Copy In Seconds with AI Use AI to boost your traffic and save hours of work. Automatically write unique, engaging and high-quality copy or content: from long-form blog posts or landing pages to digital ads in seconds.

Predict AI

Predict is an AI tool that predicts customer responses on creative assets such as attention and cognition with 95% accuracy. It is built on an industry-leading eye-tracking database and validated through neuroscientific methods.

This Model Does Not Exist

Ailice is an AI-generated influencer! A new photo of her gets posted every 15 minutes. Vote for your favorite and help decide which one she posts on Instagram each day.

Gymgenie

GymGenie is an AI-powered web application that provides customized workout routines based on individual gym goals. It utilizes advanced algorithms and machine learning techniques to generate personalized exercise plans, offering a unique and convenient solution for people looking to achieve their fitness goals. With its innovative approach and growing demand for accessible fitness solutions, GymGenie presents a great opportunity for individuals looking to enter the health and wellness space.

Journeai

Hyper personalized trip recommendations with google map integration. Whether you like antique stores or skydiving, taking small kids, crossing the Sahara desert or going on a road trip... This app can build you just the right trip to any place in the world in seconds.

Twitterbio

Generate your next Twitter bio in seconds. You can use your current bio as an inspiration for the AI to use or just write a few sentences about yourself. You can select a vibe from professional, casual and funny.

Ordinary People Prompts

Designed to escape the ChatGPT Paradox of Choice. With Ordinary People Prompts, everyone can make use of Conversational Artificial Intelligence. Learn, get inspired by others, create, vote and comment your favorite AI prompts for ordinary people.

Perplexity AI

Perplexity AI is an AI search engine. It is a demo inspired by OpenAI WebGPT, not a commercial product. They use large language models (OpenAI API) and search engines. Also answers Twitter graph queries by translating natural language to SQL code.

Elektrif

Be your best self, never run out of things to talk about, and spend more time actually getting to know someone. Elektrif.ai uses GPT3 to generate personalized conversation starters, rephrase your messages to be more engaging, etc.

SEO GPT

SEO GPT is a new way to create your SEO on-page and off-page optimizations. Some features include Google-friendly titles and descriptions, pass AI detection, natural language content and analysis of page content.

Underduck

It provides users with tools to create voice-over audio with over 5,000 expressive voices, as well as custom voice clones. It also has APIs to build audio applications and AI-generated raps. There is a case study to demonstrate how it can be used to create personalized media and a waitlist to join the upcoming Uberbots platform.

Meetgeek

Meetgeek helps maximize the value of meetings by automatically recording, summarizing, and sharing key highlights with teams. It offers real-time transcription and closed-captioning during meetings, recordings, transcripts, keyword searches, tailored tips, and AI-based notes. Integrations are available with Google Calendar, Microsoft Outlook, Zoom, Microsoft Teams, task management platforms, document repositories, and collaboration tools. There is support for multiple languages and it can send meeting summaries directly to users’ inboxes.

Longshot

Create blogs that humans and search engines love using Artificial intelligence. LongShot is an AI writing assistant that helps you and your team create helpful blogs that rank on Google.

Suggest Gift

Are you struggling to find the perfect gift for a loved one? Look no further! Our tool uses the latest AI technology to help you discover the perfect present. Say goodbye to the stress of gift-giving and let our technology do the work for you.

Stable Diffusion

Stable Diffusion is a deep learning, text-to-image model released in 2022. It is primarily used to generate detailed images conditioned on text descriptions, though it can also be applied to other tasks such as inpainting, outpainting, and generating image-to-image translations guided by a text prompt.

Eli5

Explain Like I'm Five (ELI5) is a website that simplifies complex topics using AI so that even a child can understand them. Users can select a specific topic and choose how dumbed-down they want the explanation to be, ranging from "really dumb" to "really smart". Some examples are - "How do computers work?" and "What is the meaning of life?"

Onesta

Ask their AI any questions about finance, investing, budgeting, taxes, and more. Also allows you to uncover important info about professionals who provide financial services and you can browse their advisor database too.

Buildai

Build AI helps you build AI apps in minutes. You will be able to build an app and publish it completely by yourself. You will be able to update it as you see fit, including improving and refining your prompts to make your app the best it can be.

Wolframalpha

Compute expert-level answers using Wolfram’s breakthrough algorithms, knowledgebase, and AI technology. Geared towards the subjects of Mathematics, Science & Technology, Society & Culture, and Everyday Life.

Hello History

You'll be able to have in-depth conversations with some influential and fascinating figures from history. The conversations are generated by AI, so don't take them too seriously. Each conversation is unique and you never know where it will go.

Socratic By Google

Get unstuck in your academic problems like Science, Math, Literature, Social Studies and more with help from Google's AI and also get visual explanations of important concepts in each subject.

Cody

Cody is our solution to the limitations of ChatGPT. While ChatGPT is a powerful tool, we needed an AI to work a little bit more like an employee - with the ability to be trained on your specific business, industry, and processes. ✅ Upload any document as source material ✅ Automate tasks to boost productivity ✅ See which sources were used for every answer ✅ Use it for tech support or employee training ✅ Ask it to brainstorm & give ideas

Sheet AI

Available for Google Sheets. Use AI to transform your text instructions into a Google Sheet formula quickly. Has use cases in generating programmatic SEO content, personalized emails and many more.

Teachable Machine

Teachable Machine is a web-based tool that makes creating machine learning models fast, easy, and accessible to everyone. It's meant to be used by educators, artists, students, innovators, makers of all kinds – really, anyone who has an idea they want to explore. No prerequisite machine learning knowledge required.

Excelformulabot

Transform your text instructions into Excel formulas in seconds with the help of AI. Stop wasting hours creating Excel formulas. Experience the full power of Excel & Google Sheets AI formula generators to solve problems in seconds.

Munch

Automagically Turn long-form vids into data-driven short clips for social media. Munch generates exposure and engagement by harvesting top interest from TikTok, IG, YT, and FB users and applying it to your AI-generated clips.

Glasp

Glasp is a social web highlighter that people can use to highlight and organize quotes and ideas from the web without switching back and forth between screens, and access other like-minded people’s learning at the same time. Leave your digital legacy for humanity, while working for yourself. They also provide a tool that summarizes Youtube videos.

Detect GPT

Find out if the pages you browse contain AI-generated content. Detect GPT scans the content of the webpage you are viewing and analyzes it to identify if any of the content has been generated using the GPT language model.

Jasper.AI

Create content 10x faster with artificial intelligence. Jasper is the highest quality AI copywriting tool with over 3,000 5-star reviews. Best for writing blog posts, social media content, and marketing copy.

Merlin

Merlin gives you the power of OpenAI’s ChatGPT on all your favourite websites. Ex: Gmail, g-sheets, Twitter, Linkedin, etc. Anywhere you search or write online. With Merlin you can quickly edit your emails, write twitter replies or create excel formulas.

Pollinations

Pollinations wants to diversify creativity and spread it through digital ecosystems. Whether in image, video or audio, we invite people to imagine new worlds with the help of AI. For companies, our developers write code on top of the latest AI models, providing customized outcomes and specific aesthetics. With the API , AI creation can be integrated directly within websites and social media platforms. Creating gets easy, fast, and fun.

Paperbrain

A platform for you to access and understand research papers. With paper abstracts and direct pdf links, you'll never have to struggle with tedious downloads again. Built with a GPT assistant to help you all along.

Ideasai

Ideas on this page are 100% generated by OpenAI's GPT-3, an artificially intelligent deep learning model, without human involvement, and trained by you and 1,457,521+ other people who liked or disliked ideas

Mubert

Areyoutiredofscouringthewebfortheperfectroyalty-freemusicforyourcontent?LooknofurtherthanMubert,theinnovativenewmusicecosystemdesignedspecificallyforcontentcreators,brands,anddevelopers.AtMubert,weunderstandtheimpactthatgreatmusiccanhaveonyouraudience.That'swhywe'vecreatedaplatformthatmakes[…]

Profilepicture.AI

Create your perfect profile picture with AI. Your profile picture is the first thing people see when they look at your profile. We use artificial intelligence to generate an image of you that looks perfect and captures who you are. You can be anything, anywhere, or anyone!

Validator AI

AI business validator for any idea. Validate and receive constructive feedback on any startup idea, powered by AI. It first lists out potential struggles you may encounter when running the business and then gives it's overall feedback about your business idea.

Piggy To

Create an engaging and shareable webpage in seconds. By entering a prompt, the tool generates 7-10 slides in a mobile-friendly format, saving time and ensuring visually appealing content. Ideal for businesses and individuals, Piggy Magic offers a user-friendly, time-saving solution for creating impactful content. You can also mention their twitter bot with a topic to get a beautiful piggy about that topic within a minute (for example - "@makeapiggy most popular books")

Chatgpt Writer

Free Chrome extension that uses ChatGPT AI to generate emails or replies based on a few keywords you input. Currently supported for Gmail. Supports all popular languages, simply mention it in the text prompt.

Boomy

Make instant music and share it with the world. Create original songs in seconds, even if you've never made music before. Get paid for every listen on platforms like Spotify, TikTok, YouTube, and 40+ others worldwide.

Midjourney

AI art generator based on Stable Diffusion. Their website describes them as "an independent research lab exploring new mediums of thought and expanding the imaginative powers of the human species."

Writesonic

Writesonic is an AI writer that creates SEO-friendly content for blogs, Facebook ads, Google ads, and Shopify for free. Our paraphrasing tool lets you rephrase entire articles instantly.

Looka

Lookaisafreelogomakerandintelligentbranddesignerthathelpsyoucreatealogoandbuildabrandyoulove.WithLooka,youcaneasilycreateauniquelogothatreflectsyourbusinessandstandsoutfromthecompetition.Looka'sintuitivedesigntoolsmakeiteasytocustomizeyourlogotofityour[…]

Midjourney

AI art generator based on Stable Diffusion. Their website describes them as "an independent research lab exploring new mediums of thought and expanding the imaginative powers of the human species."

Tome

Tomeisarevolutionarywebappthatbringsgenerativestorytellingtothenextlevel.WithTome,youcanunlockyourbestworkandcreatestoriesthataretrulyunique.PoweredbyAI,Tome'sstorytellingformathelpsyoucraftstoriesthatareengagingandcaptivating.Tomeiseasytouseandaccessibletoeveryone.Withits[…]

Writesonic

Writesonic is an AI writer that creates SEO-friendly content for blogs, Facebook ads, Google ads, and Shopify for free. Our paraphrasing tool lets you rephrase entire articles instantly.

Video

Dubb

An automated, easy-to-use assistant that generates marketing content for your podcast. Dubb turns your podcast episodes into show notes, social media posts, newsletter content, transcripts, and more.

Lemonaid Music

Lemonaid is an AI-powered tool designed to help musicians of all experience levels create unique and custom music. It offers millions of ideas at the click of a button, with features such as "beat block" eliminator and A.I. powered limitless possibilities. It also offers a limited edition Mac + Windows download at a discounted price.

Listener.Fm

Get started by uploading your podcast episode to your dashboard, where it will be securely stored and managed. Take a break and let AI do the heavy lifting - effortlessly crafting attention-grabbing titles, compelling descriptions, and engaging show notes tailored to your specific episode. With your episode now perfectly packaged and polished, easily publish your podcast to your audience with powerful, eye-catching titles, informative descriptions, and captivating show notes that will help drive engagement and grow your following.

Staccato

When you need some inspiration for your music, Staccato Music can suggest what comes next. Simply add a MIDI file you're working on, change the parameters to suit your needs & and watch as new music is written for you in the same key, style & mood. You can also use it to generate lyrics for your music by giving necessary keywords.

Prodia

Prodia is revolutionizing the way AI is integrated into various software applications. With a vision to make AI accessible to all, Prodia offers a fast and easy-to-use API for image and music generation.

Pixelforge

PixelForge is a tool that helps users verticalize videos for platforms such as TikTok. select a YouTube video, process a time period of up to 5 minutes, dcenter frame, and compose a shorter version of the video. The tool provides the user with results that they can compare and download.

Audyo

Audioshake

Get your Stems for sync licensing, sampling, remastering, remixing, and re-imagining and get the tech used by major labels, publishers, distributors, music supervisors and sync licensing companies

Quinvio AI

Scribble your content ideas with AI suggestions to improve your writing performance. Start by outlining the topics and prompt different ideas until you find one that best matches your presentation vision. Create an outline of ideas, review AI content suggestions and pick your spokesperson.

A.V. Mapping

Find your music from video, images, and text with AI in 3 steps. Upload video, choose recommendations, and pay for contracts. That’s all users need to do. Compared with the 6 months duration, A.V. Mapping hopes it can be the most helpful AI for creators.

Visla

Visla is an efficient tool for creating and customizing videos quickly and easily. It offers AI-generated content and editing tools to make videos that capture audiences. It also provides auto-transcription, embedded videos, and suggested footage for creating professional-looking demos.

Zeemo

Castmagic

Flawless AI

Flawless is a company that is using advanced technology and artificial intelligence to revolutionize filmmaking. Their world-first system allows for visual dubbing, AI reshoots, and visual translations. This allows films to reach wider audiences and be translated into different languages without losing any quality or authenticity. Their patented approach focuses on preserving expressions at the cinematic level, and their team consists of industry pioneers who have done important research in neural rendering and machine learning. They have been awarded TIME's "Best Inventions of 2021" award.

Voiceful.Io

Cassetteai

Bring your music to life with Cassette using cutting-edge AI. Whether you're a professional music producer or just starting out, Cassette will help you create high-quality beats in no time. With its advanced AI technology, Cassette can generate unique beats and rhythms that match your musical vision. Simply describe your beat to the artificial intelligence model and the app will do the rest. Cassette AI is the ultimate tool for anyone looking to create stunning, electronic music and is perfect for musicians of all skill levels.

Decoherence

Create AI animations and synchronize them with your music. Write your prompts, choose your effect, set it to audio channels, and create your story today. There are two tiers of pricing - $10 for a top up or $30/month.

AI Studios

99% Reality AI Avatar. Generate realistic AI videos quickly and easily. Simply prepare your script and use our Text-to-Speech feature to receive your first AI video in 5 minutes or less. ChatGPT + Generative Video AI = You Can make Great Video!

Piano Genie

Use the 1-8 numbered keys on your keyboard (or the home row a-f and j-;) or touch the coloured blocks to play the piano. Use the space bar to control the sustain pedal. The more you pretend you're a real player, the better the melody (and you!) will sound.

Move

Capture high-quality motion data from video in any environment using mobile phones. Their patented software extracts natural human motion from video using advanced AI, computer vision, biomechanics and physics, automatically retargeting the data to your character rig. Capture motion anywhere and export directly into any game engine or digital environment.

Rephrase AI

Rephrase.ai's deep tech generative AI technology creates a professional-quality video with real human avatars for content generation and business communications. Innumerable video variants can be rendered with single live-action footage of a person with just the text script as input.

Captions

AI-powered camera and editing app that helps you create videos with captions, automatically. With one tap, you can start recording, and your words will appear on screen in real-time. You can customize your captions, clip and edit your video, and then share it to social media.

Lalal.AI Voice Cleaner

A next-generation vocal remover and music source separation service for fast, easy and precise stem extraction. Remove vocal, instrumental, drums, bass, piano, electric guitar, acoustic guitar, and synthesizer tracks without quality loss.

Clippah

Capturelab

Vocal Remover

Split music into separated vocals and instrumental track. Perfect for making karaoke backing tracks or accapella extractor. Once you choose a song, artificial intelligence will separate the vocals from the instrumental ones. You will get two tracks - a karaoke version of your song (no vocals) and acapella version (isolated vocals). Despite the complexity and high cost of service, you can use it absolutely free. Processing usually takes about 10 seconds.

Ttslabs

Polymath

Supercreator AI

Create an original video script from an article you wrote online. Use existing scripts that are relevant to your audience. Easily customize scripts to better match your desired style

Noise Eraser

AI noise reduction tool that helps people make their voices clearer. With just one click, people can get a professional audio effect for their videos. It also offers a professional AI audio processing solution, allowing users to adjust the voice/noise ratio instinctively.

Brain.Fm

Brain.fm’s focus music is made to help you work better, by blending into the background so you can focus distraction-free. All while stimulating the brain with gentle rhythmic pulses in the music that support sustained attention.

Vizard

Let content marketers create professional-looking webinar recordings, conference recordings and customer testimonials easily. Anyone can repurpose existing video assets into high-conversion content. Save up to 80% of your time and budget on video production. No editing experience required.

Clips AI

Clips AI automatically creates social media clips from long-form videos like podcasts, webinars, and vlogs. This allows content marketing teams to save time and easily increases metrics on socials.

Maverick

Fineshare

FineShare offers two products - FineVoice is an AI digital voice solution suited for streamers, podcasters, content creators, and gamers. Use FineVoice to color your voice and bring it to a level. FineCam is a free AI-powered virtual camera that turns any camera you have into a high-quality webcam with up to 4K resolution and improves your appearance in videos by adding backgrounds including images, videos, slides, webpages, application windows, etc. and stunning webcam filters & effects. It works with all your favorite video calling and streaming apps such as Zoom, Microsoft Teams, Twitch, OBS, Adobe Premiere Pro, etc.

Playlistai

PlaylistAI is an app that helps people create their own playlists. It can generate playlists from AI prompts, images, videos, and music they already like. It's features include turning any music festival poster into a playlist, identifying songs in TikToks and other videos, and creating your own music festival lineup. It has been featured in various publications like FastCompany, TechCrunch, and MusicRadar. It was previously known as LineupSupply.

Moji Writing Assistant

Shuffll

Shuffll is a cutting-edge video production platform that uses AI technology to streamline the creation process. Our platform allows businesses to easily create high-quality, personalized video content in a fraction of the time it would take using traditional methods.

Adobe Podcast

Provides 2 free quick tools to enhance audio for your content. Enhance speech- Enhance speech by removing all background noise and echo. Mic Check - Unlock quality sound from your microphone. The main product promises to provide AI-powered audio recording and editing, all on the web and is under waitlist.

Creative Reality Studio (D-Id)

The world’s first platform to combine GPT-3, Stable Diffusion, and D-ID’s unique face animation technology. Our generative AI will turn your vision into a talking avatar within seconds.

Munch

Riffusion

Riffusion generates music from text prompts. Try your favorite styles, instruments like saxophone or violin, modifiers like arabic or jamaican, genres like jazz or gospel, sounds like church bells or rain, or any combination

Fliki

Create videos from scripts or blog posts using realistic voices in 2 minutes! Transform blog articles into videos. Lifelike Text to Speech Voices. Rich stock media library. Trusted by 30k+ content creators from companies like Google, Meta, Bytedance and Upwork.

Fliki

Photo

Short Description Image Generator

From a short description and based on the database from MagicPrompt-Stable-Diffusion from HuggingFace + the API of StableDiffusion; images can be created based on few words.

For The Wall

Create your own unique and personalized art prints with forthewall.art! Our AI-powered platform lets you generate stunning works of art from scratch. Order your one-of-a-kind print today and transform your blank walls into something special. Try it out now at forthewall.art!.

Mysticlabs AI

MysticLabs AI tools are focused on semantic searching and retrieval systems and their aim is to build Generative AI tools that ease the workflow of enterprises and startups. Their models include OpenAI GPT 3.5, Instruct GPT, and Huggingface Bloom.

Maskr.AI

Users can take a picture of themselves using Maskr.ai and replace themselves with any celebrity of their choice. It includes an extensive database of A-list celebrities to help you locate the right match, as well as automatic facial recognition technology to ensure a flawless replacement. Users can also add a dash of fun by selecting some amusing facial expressions. The GPT feature can be used by users to create the ideal photo caption.

Qikpm

Lensco

Use AI to generate photos that look perfect and capture who you are. You can be anything, anyone or anywhere! Upload 20 photos. Select the type of photos you want. Generate photos aka. "start the photoshoot". View your photos after the photoshoot is done. If you're not fully happy with your output photos, refine your photoshoot recipe and shoot again!

Deepagency

Prodia

Supares

SupaRes is an AI-powered image enhancement platform that provides a one-stop solution for automatically enhancing images. It offers features such as Super Resolution, Face Enhancement, Tone Adjustments, Artifacts Reduction, Low-Light Boost, and Noise Removal. Users can upload an image to the demo app and get a high-resolution image with improved clarity, quality, and sharpness. The platform also provides an intuitive UI with unlimited cloud storage, team management, account security, and premium support.

88Stacks

Producing eye-catching and engaging images that fit with your brand's image and messaging is crucial but can be time-consuming and challenging. Images that tap into current events and popular culture are more likely to be shared, liked, and commented on by followers, increasing overall engagement on the brand's social media platforms. 88stacks provide an endless stream of content for you.

Whimsical AI

Solidgrids

Visualizeai

AI-based tool that can convert wireframes into rendered drawings, providing a realistic and accurate visualization of design ideas including faster design iterations, improved communication with stakeholders, reduced errors and rework, and ultimately, a more efficient design process. The tool uses advanced algorithms and machine learning techniques to analyze wireframes and generate realistic 3D renderings of the proposed design. The tool can also take into account factors such as lighting, materials, and textures to produce a highly accurate representation of the final product.

Fabrie AI

Fabrie AI are adding GPT and Stable diffusionto their infinite whiteboard. Making it an unified workflow in the creative process. AI-generated text and images are becoming increasingly advanced, to the point where they can closely resemble natural communication for humans. With this technology, designers are able to quickly obtain a large amount of information and inspiration, enabling them to work more efficiently and effectively.

Flying Dog

Add DALLE 2 and Stable Diffusion to Adobe Photoshop. Has several features like Text to Image, Image to Image, Inpainting, and a new server for Outpainting. You also get a proven workflow to preview and adjust images

Evoke

Imagen AI

Imagen AI can generate unlimited variations from a single photo. Letting you to visualize different designs with changing some of the elements but keep the majority of the look and feel the same.

Neuroflash

Facetune

Experiment with the top selfie editor in the world and bring your unique vision to life. From casual selfies to artsy shots Whiten your teeth (or even your sneakers) and give yourself just the right amount of glow with our tools that were designed to help you shine. You are the spotlight. Be the center of attention and dial in lighting or use our ring light feature to bring out that inner glow. Celebrate your own style. Easily try different makeup looks or try the hair color you've always wanted - no commitment necessary

Rundiffusion

RunDiffusion is a cloud-based platform that helps people create images for their projects. It offers users a variety of pre-loaded models, industry-leading boot times, integrated file browser, and secure sessions that protect from overcharges. It also offers a pricing plan based on usage and refunds unused time.

Pagegenie

PageGenie takes the hassle out of creating a feature list for your product. The tool automatically generates a list of features based on your product and includes them in your landing page. This means that you can easily showcase the unique benefits of your product to potential customers without spending hours manually creating a list, it also generates images and gallery that showcases your product in the best light possible. With their image and gallery generator, you can easily showcase visually appealing and high-quality images and galleries based on your product.

Synthesys X

Synthesys X analyzes objects and patterns in any picture you come across and generate new images based on their similarity and relevance to those objects/patterns found within the original image.

Kittl

Whether you need to create eye-catching merch designs or beautiful social media posts - Kittl AI will 10x your design skills and bring your creation process to the next level. Easily generate stunning images from text descriptions in just a few clicks and continue working with your creations directly on your artboard.

Remini

Vectorizer AI

Yarnit

Yarnit App is designed to reduce the time, cost, and complexity of digital storytelling/content creation with an AI-based guided service, which leverages best practices from storytelling and multi-media communication.

Sivi

A graphic design tool that uses artificial intelligence to quickly and easily create product banners, Google display ads, Facebook ads, and other visual designs. It enables users to quickly create original compositions, limitless variations, and designs that look professional. It helps creating visually appealing ads that convert more effectively and quickly for marketers, business owners, content writers, and e-commerce managers.

Mergeml

MergeML is an AI image generation tool that allows users to create unique and high-quality images using artificial intelligence algorithms. The tool uses a machine learning model to merge multiple images together, creating new and original designs. It uses a machine learning model called StyleGAN2 to generate the new image. This model has been trained on a large dataset of images and can generate high-quality images that look similar to the input images.

Neuralcanvas

Neural Canvas is a digital illustration generator service able to generate unique illustrations for your comic, blogpost, e-book, story, collections, and more. Create your own AI-generated comic using it.

Befunky

BeFunky Photo Editor lets you apply photo effects, edit photos and create photo collages with collage maker. It has features like cropping, resizing, batch editing, background removal, retouch portraits, one click collage maker, several design templates, millions of stock images and thousands of vector graphics and icons.

Kaiber

Kaiber.ai is an amazing tool that allows you to animate your photos and bring your memories to life. This incredible technology uses artificial intelligence to bring your photos to life in a unique and exciting way. With just a few simple steps, you can turn your still photos into dynamic moving masterpieces. Kaiber.ai makes it easy to relive your favorite moments and keep your memories forever. Whether you're looking to create a special video to share on social media, or just want to keep your memories in a fun and innovative way, Kaiber.ai is the perfect tool for you.

Textgpt

Appicons AI

Booth AI

Fast, inexpensive, high-quality images produced via AI with no physical samples required. Easily generate professional-grade product photos by uploading an image of your own product and creating your desired outcome by writing a simple prompt.

Cartoonize

Imagetocartoon is an avatar maker that uses artificial intelligence to convert your photos into cartoon versions. The app has a simple interface that makes it easy to apply the cartoon effect to your images. It also offers a wide range of cartoon effects, including traditional, watercolour, sketch, and more. This means you can choose the style that best suits your image and personal preference. To make carton avatars for yourself, all you have to do is upload the photo you want to transform, and click “convert” to process the image. The app will then apply the cartoon effect to your image in just a few seconds. You will get over 30 stunning cartoon avatars for 1 image uploaded. Turning your images into cartoons can be a fun and creative way to express yourself. It can also be a great way to add some personality and humour to your social media posts. Feel free to use imagetocartoon to create unique and eye-catching cartoon avatars for your business or personal brand.

Candyicons

Find beautiful app icons for your product. Access our massive collection of stunning app icons and choose the ones you like best. You get full copyright ownership and unique high-quality icons that support iOS, macOS, and Android projects. There is also a customized favicon generator.

Freeimage.AI

With a very simple and clean UI, users can use the tool to generate images 100% free by entering any prompt they want. They use stable diffusion on the backend. Many people face problems running stable diffusion locally since they lack resources. The tool solves this problem by allowing anyone to use the tool for free without limits and without worrying about resources.

Midjourney Splitter

Lucidpic

Lucidpic is an AI photo studio. Generate quality stock photos of people that don't exist, in seconds. Adjust clothing, hair, style, and even age to get the perfect photo. Perfect for websites, social media posts, elearning and advertising. No model release required, photos are 100% royalty free.

Bright Eye

Moji Writing Assistant

Pixelhunter

Cropping each and every image by hand can be tiresome. Pixelhunter utilizes amazing Uploadcare Intelligence API to recognize objects and crop pictures automatically, in a smarter way.

Imagecolorizer

Imagecolorizer is a cutting-edge application that uses advanced AI technology to colourize black-and-white photos with stunning accuracy and detail. Once the user uploads an old photo, this site will analyze the image and intelligently apply proper color to different parts of the photo. The image restored by the app will look vivid and fresh. This colorizer application works well on damaged and blurred old photos. In addition, it also offers some other powerful features for you to enhance your photos’ quality further. If you want to restore old photos and bring new life to your images, try image colorizer without hesitation!

Pebblely

Pebblely is an AI tool that turns boring product images into beautiful marketing assets in just seconds. The AI creates backgrounds based on your uploaded images and adds shadows and reflections accordingly.

Visily AI

Visily enables teams with diverse design backgrounds to create stunning wireframes and prototypes at light speed. Boasting a wide range of AI-powered features, Visily also has pre-designed templates, prototyping, and collaborative features to make designing an easy & intuitive experience.

Cleanup.Pictures

A retouch technology used to remove any unwanted objects from photos (object removal). It can be used to remove an unwanted person. It used to work with a clone tool like the inpaint, but using artificial intelligence gives much better results today.

Green Screen AI

Green Screen AI lets you change the background of your pictures to whatever you can think of! Using generative AI, you can place your dog in an alien jungle or turn your cat into a space-cowboy.

Predict AI

Stable Diffusion

Magic Eraser

Create stunning visuals in seconds with their AI image editing tools. Remove unwanted things, switch backgrounds or enlarge your pictures - all without Photoshop or Illustrator. Create pictures with words or let AI create stunning profile pictures of you - it’s magic!

Sales

Ravyn

Ravyn's AI automatically captures and categorizes insights directly from your notes. As you capture insights, Ravyn automatically builds next-gen client profiles that fuel deeper relationships and meaningful engagement. Ravyn is the only sales platform in the world that provides a more complete and human view of your clients so you can turn cold business contacts into happy clients for life.

Caffeinated Cx

Attention

Salee

Analyze and apply intelligence in every step of your LinkedIn outreach. Manage messages in a simple and flexible way., Generate personalized intros, presentations, and follow-ups. Every message you send is tailored to your target audience, making sure you capture their attention and build strong connections.

Hirepeople

Everylead.AI

Everylead.ai lets you upload a CSV of leads and it then writes customized ice breakers as well as professional summaries for each lead based on their LinkedIn profile. Just upload a CSV of your leads and we summarize their professional experience as well as write a highly engaging ice breaker to include in your outbound campaign.

Akkio

Akkio is a no-code machine learning platform that enables businesses to quickly and easily leverage AI to make data-driven decisions and grow their business. The platform enables users to combine columns, summarize records, reformat dates, clean data and remove outliers, and make predictions from historic data.

Cargo

An automated platform that helps businesses make the most of their data. Its features include advanced analytics, automated reports, machine learning, A/B testing, and integrations. It helps sales and marketing teams align and build custom workflows to drive revenue faster.

Cuetap.Com

Win more deals with Cuetap's AI-powered Sales Battlecards and Competitive Intelligence Cuetap's AI-powered platform provides automagical Battlecards and actionable Competitive Intelligence

Trade Foresight

Markopolo

Sku Fetch

List products from wholesale and retail suppliers to multiple marketplaces, such as Amazon, Ebay, Shopify, Walmart, Newegg, Facebook etc. and harness the power of AI to rewrite/expand/change/summarize title and/or description and update images. Sku Fetch also uses AI to fetch hard to get product pages from retailers.

Write high-converting emails, 10x faster. Save countless hours writing. Use AI to generate powerful copy for hundreds of different email marketing campaigns, drips, newsletters and more.

Code

Adrenaline

Fix your broken code in seconds using Adrenaline, Stop pasting error messages into Google and use AI to debug your code and teach you along the way. Input your code and describe the problem, and Adrenaline will propose a fix with just one click. For more advanced errors, diagnose them by discussing your code with the Adrenaline chatbot.

Virtuoso Qa

Xata

Vfitter

Custom AI Bot builder for freelancers, organizations, and brands for AI assisted content creation. Users can use the AI to create custom No-Code AI tools, generate brand-specific logo designs, market-based research, fulfill HR tasks, legislation specific legal research and many more. AI helps improve branding power, presence, reach, and productivity an organization's image and digital presence.

Luminal

Outset.AI

Parnassus Labs' Outset is a tool that enables companies to integrate AI into their products without needing AI expertise. It provides access to large language models such as GPT3, allowing for the quick integration of generative AI functionality. Additionally, Outset helps to develop, test and maintain AI features, as well as optimize them for specific use cases. It also provides suggestions for how generative AI can be used to benefit businesses.

Block Survey

BlockSurvey enables digital rights for the users. Meaning, the account or identity ownership and data ownership is with the user and not with the platform provider. With BlockSurvey, all your data is encrypted end to end and you have the keys for them. This prevents data breaches, leaks, harvesting and trust issues. We strongly believe all your ideas and insights gathered from people through data collection is valuable and it needs to be protected. BlockSurvey enables that with a modern privacy focused design system using BlockStack's Blockchain. One of their features allows you to use AI to create forms.

Magick

Supercharge your apps with AI and build them in our easy-to-use low-code interface. Whether you're an experienced developer or new to the world of AI, our platform makes it simple to get started. You don't need to spend hundreds of hours and thousands of dollars on scaling infrastructure and hosting models. With Magick, you have the power to build world-class AI applications in just a few clicks.

Sourceai

SourceAI is an AI-powered tool that can generate code in any programming language from any human language description. It can also simplify, find errors and fix them and debug your code.

CustomGPT enables companies to design their own unique AI-powered chatbots. With its simple setup, OpenAI-powered features, and flexibility to share the bot with private, public, or protected access, CustomGPT offers businesses a potent way to boost productivity, enhance customer satisfaction, and gain a competitive edge. It has features like seamless Sitemap integration when ingesting content.

B12.Io

B12 is an AI-powered website builder that helps professional service providers create a professional website, streamline business operations, and improve client engagement. It offers a team of experts and an industry-specific website draft generated by AI technology.

Google Colab Copilot

AI Python coding assistant on Google Collab. To get setup, 1. Copy the Javascript from Github. 2. Replace "" in the script with your OpenAI API key. 3. Open and paste the script on your console on Google Colab. Follow this setup guide. 4. Shift + Alt + Enter on Google Colab.

Sketch is an AI code-writing assistant for pandas users that understands the context of your data, greatly improving the relevance of suggestions. Sketch is usable in seconds and doesn't require adding a plugin to your IDE.

Prisms AI

Prisms is a no-code platform for building AI-powered apps. By harnessing the power of large language models such as GPT3, DALL-E, and Stable Diffusion, you can connect data sources and user inputs to create their app. You can then deploy your app directly from Prisms with a pre-built UI, or use Prisms as a backend to build their own frontend. Prisms is launching in 2023, and those interested can get on the waitlist. They can also check out what the Prisms community has built.

Ask a question in English (natural language) and automatically generate the SQL, answers and visualisations you need. Collaborate with team mates to quickly create dashboards and then explore your data further with Channel’s suggested questions.

Hacker AI

Bardeen AI

Bardeen uses AI to automate manual workflows, save you time, and empower your creativity. Some examples of automations include: - Get action items from the last meeting and add them to Notion. - Summarize any website and save it to Notion. - Respond to a question from the current page's content. - Create an image using AI with OpenAI's Dall-E.

Safurai

AI Cli

Lookup

Get answers from your data in seconds. Lookup is the AI-powered analytics platform that helps you get from data to insight 10X faster. Import your data, ask questions, get results instantly.

Visily AI

Amazon Codewhisperer

Chatgpt Website Builder

Build websites including copy & images in 30 seconds. Fill in the form and have an AI generate website built and ready at your disposal complete with text, images and styling.

Ghostwriter

Replit recently added a feature called Ghostwriter that uses AI to complete code. Write and run code in 50+ languages in your browser with Replit, a powerful IDE, compiler, & interpreter.

Softr Studio

Build custom apps for your business, as easy as lego. Generate images and copy within Softr with just one click using their AI. Turn your Airtable or Google Sheets into client portals, partner apps or internal tools.

Teachable Machine

Codeium

Codeium is the modern coding superpower, a code acceleration toolkit built on cutting edge AI technology. With easy integration into editors, you can focus on being the best software developer, not the best code monkey.

Fun

Lemonaid Music

Maskr.AI

Mememorph

MemeMorph is an advanced face-morphing app that allows users to turn themselves into their favorite memes by uploading a few selfies. The AI does the rest of the work, generating over 127+ memes for a one-time payment of $6.99. The app also includes a built-in meme builder, allowing users to create and customize their own memes. MemeMorph is developed by ProfilePicture.AI and all data is stored securely on servers in the United States.

GPT-Me

Heymind

HeyMind is a mobile app that provides users with access to wisdom and teachings from various historical figures, including Alan Watts, Lao Tzu, Jed McKenna, Rumi, Nietzsche, M. Angelou, Walt Whitman, Plato, Confucius, U.G Krishnamurti and more. The app allows users to gain knowledge and insight into life, the mind, and the world around them, and provides them with tools to better understand themselves and their journey.

Celebrity Voice Changer AI

Piano Genie

Animeai

Caricaturer.Io

This Resume Does Not Exist

Stand out among the competition with over 1000 AI-inspired resume examples. See what works for the resumes of the world’s most successful people, and create a resume that’s just as good.

Gen Z Translator

A fun AI project that converts any given text to Gen Z slang. The tool would be able to identify words and phrases in the original text and then replace them with their corresponding slang words or phrases. Translated 2000+ sentences into tweets or something, idk.

AI Pencil

AI-based software, Sketch AI, allows users to create stunning artwork with the help of powerful tools, import and export their favorite drawings, and transform their art into any medium or style.

Background.Lol

This website helps you create beautiful wallpaper designs with the help of artificial intelligence (AI). You can choose from a range of options such as anime, sunset, space, futuristic, forest, and world. All you have to do is press the relevant button, and you will have your wallpaper ready! In addition, you even have the option to upscale your image to 4K resolution if you wish.

Imagecolorizer

Oss Insight

Find Your Next Book

Instanovel AI

Maps GPT

Unreal Meal

A collection of AI-generated images of meals that don't exist. You can use these images for a variety of purposes, such as in the development of new recipes or as part of a creative project.

This Model Does Not Exist

Ailice is an AI-generated influencer! A new photo of her gets posted every 15 minutes. Vote for your favorite and help decide which one she posts on Instagram each day.

Journeai

Eli5

Piggy To

Copywriting

AI Copywriting Tool specifically designed for Digital Agencies and Small Businesses. It makes it fast & easy to create sales-driving content for business websites, Google My Business, Yelp, Facebook Linkedin, Youtube, and more.

Neuroflash

Lebesgue

Snapgpt

With SnapGPT, you can simply take a photo and let the app do the rest. SnapGPT uses the latest OCR technology to extract text from images and the OpenAI GPT-3 API to answer any questions you have about the text.

Seenapse helps creative teams at marketing and advertising agencies to come up with more, better ideas faster. It generates hundreds of interesting ideas in minutes, through a unique combination of human lateral thinking and AI.

Post AI

Textcortex AI

Hyper charge your writing wherever you need it in your browser. Write better, faster, from everywhere with TextCortex. Available in 25+ languages. TextCortex is an AI companion that is designed to understand you and your writing needs: it actively presents options on how to make your content more authentic, and assists you in your creative process, from start to finish, like never before.

Superflow Rewrite

Now you can rewrite your landing page copy in context using ChatGPT. Once you install Superflow on your website, just select any text, hit "rewrite" button and boom! You have an amazing new copy for your product. You can preview changes in context and once you find something you like, create a task for your team to make the change.

Newswriter.ai is an AI-powered press release writing tool that helps you create compelling, eye-catching press releases in minutes. Using GPT-3 OpenAI technology, Newswriter provides two services: writing a press release from scratch, or improving an existing press release. You can also access Newsworthy's news marketing tools to get more eyes on your news by distributing it to Google News and 500+ other websites.

Yaara

Yaara AI will help you generate creative content from a given prompt with improved grammer and flow of existing content. It will help summarize long documents into shorter pieces. Write long-form pieces such as articles, blog posts, or even books.

Art

An AI assistant that is always ready to help founders and startups navigate the complexities of business modeling and market analysis. This can help founders save time and resources, reduce risk, and increase their chances of success in the highly competitive world of business.

Stride

Kraftful

Kraftful helps you understand what users need to quickly get to product-market fit, scale your user base, and grow revenue. Save hundreds of hours analyzing feedback with our GPT-3 powered solution to uncover user needs. Track how users perceive your product to measure the real impact of your iterations over time. Learn about user needs from your competitors’ users to stay one step ahead of the industry

Caroot

AIgur.Dev

Deep Anime

With the help of the potent programme Deep Anime, anyone can turn any photo into a beautiful anime scenario. It applies a range of altering neural networks to the photo after using cutting-edge artificial intelligence to automatically identify faces and objects to create a distinctive and dynamic style.

Ultrabrainstomer

Namesnack

NameSnack was trained on millions of real business names. It doesn't just mash random words together. It actually understands the preferred naming patterns in different business categories and it only suggest names that are still available to register as a .com or .co.uk domain.

Stable Attribution

When an A.I. model is trained to create images from text, it uses a huge dataset of images and their corresponding captions. The model is trained by showing it the captions, and having it try to recreate the images associated with each one, as closely as possible. The model learns both general concepts present in millions of images, like what humans look like, as well as more specific details like textures, environments, poses and compositions which are more uniquely identifiable.

Vieutopia

Tested with thousands of different images and text combinations, this app allows you to transform your wildest ideas into creative works of art with no subscription costs or usage limitations.

AI Pencil

AI-based software, Sketch AI, allows users to create stunning artwork with the help of powerful tools, import and export their favorite drawings, and transform their art into any medium or style.

Background.Lol

Instantart.Io

InstantArt is a revolutionary new platform for AI-generated art. Their stable diffusion technology ensures that every image generated is of the highest quality, making it the perfect tool for artists, designers, and creators of all levels. Whether you're a professional looking for inspiration or a hobbyist looking to experiment, InstantArt has something for everyone.

Pixelicious

Releasenote.AI

Namy AI

Namy is a simple tool to generate some domain name ideas for your business or brand. Simply enter a few details about your product or brand and hit “Generate!“. The tool will give you a list of fitting domain names, and also tell you if they’re registered or not. Namy uses the Namecheap API to check which domains have already been registered

Cody

Chatbots

Others

Video

Photo

Sales

Code

Fun

Copywriting

Art

Friendly link